Recombinant Neurospora crassa Palmitoyltransferase PFA4 (pfa-4)

Shipped with Ice Packs
In Stock

Description

Functional Role and Biochemical Significance

PFA4 is classified as an acyltransferase (EC 2.3.1.-), catalyzing the transfer of palmitoyl groups to proteins or lipids. In Neurospora, its role is linked to fatty acid metabolism and membrane lipid composition:

Fatty Acid Metabolism

  • Desaturation and Lipid Synthesis: Mutants lacking pfa-4 show impaired synthesis of polyunsaturated fatty acids (e.g., α-linoleic and α-linolenic acids) but retain oleic acid production . This suggests PFA4 may regulate downstream lipid modifications or interact with desaturase pathways.

  • Membrane Fluidity: Polyunsaturated fatty acids influence membrane dynamics, and PFA4’s dysfunction could disrupt temperature adaptation in Neurospora .

Protein Palmitoylation

While direct experimental data on the recombinant enzyme’s activity is limited, its classification as a protein fatty acyltransferase implies involvement in post-translational modifications (PTMs). Palmitoylation typically enhances protein membrane localization or interaction with lipid rafts .

Research Applications and Tools

Recombinant PFA4 is utilized in studies of lipid metabolism and protein modification. Key applications include:

ApplicationDetailsSource
Lipid BiochemistryInvestigating fatty acid desaturation and metabolic pathway regulation
Protein ModificationStudying palmitoylation’s role in protein trafficking or signaling
Enzyme KineticsCharacterizing substrate specificity and catalytic efficiency in vitro

Comparative Analysis of Recombinant PFA4 Preparations

Commercially available preparations vary in production methods and tags:

PreparationHost SystemTagPuritySource
PFA4 (Q7SCY6)E. coliN-terminal His>90% (SDS-PAGE)
Partial PFA4Cell-freeNot specified>85% (SDS-PAGE)
His-Tagged Full-LengthE. coliHis>85%

Research Findings and Implications

  1. Fatty Acid Synthesis Defects: pfa-4 mutants in Neurospora exhibit reduced polyunsaturated fatty acid levels, suggesting PFA4’s role in desaturation or lipid processing .

  2. Genetic Mapping: pfa-4 maps to a distinct locus, indicating independent regulatory pathways for fatty acid metabolism in Neurospora .

  3. Structural Insights: The recombinant enzyme’s sequence contains motifs for acyltransferase activity, aligning with its functional classification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery time.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ptr-4; pfa4; NCU02118; Palmitoyltransferase pfa4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
ptr-4
Target Protein Sequence
MTNLQTGPTTRGLQRFAIPAVCGLIIFLGYYSQYLFNTSADLAPGPLTCRESLIFNILLV CLWLTYYQACTVDPGQYKFPPKEKEDGDNNNKRGGRGPQKAKWCKKCDAPKPPRAHHCRH CARCIPRMDHHCPWTGNCVSLQTFPHFLRFLVYTNAALVYFARLLWTRLYYGLWDQRHVP AYLGPSVGALLGCTMLSIAWFATQFALMVLLVTTVRSWMLGKTMIEEWEAERHETLLARS YDGDDYWGADGHGGFVPVKVEFPYDNGFWSNMAQAMGTNNFLRWFLPVGGGGPKISNDTP WKGTGWEYEENGFNDRVGMWPPPDPEKLRRERAGAGGKWPGARENLNTEKPEVDYYRSSE DMKTAFKRRQQEDLRRRQQRRQHSSEEDEIMAELEEDEGYEQRSRTRSPPQDGRAWMNSE GDTLWDYGVDVDEEENYGYPGQGVSESLPLVKTATGYNDGQGDEDEDVPLAELIRRRKVK SNGVHE
Uniprot No.

Target Background

Function
PFA4 (pfa-4), a palmitoyltransferase from Neurospora crassa, mediates the reversible addition of palmitate to target proteins. This process regulates their membrane association and biological function.
Database Links

KEGG: ncr:NCU02118

Protein Families
DHHC palmitoyltransferase family, PFA4 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is PFA4 (pfa-4) and how is it characterized in Neurospora crassa?

PFA4 (pfa-4) is one of five identified mutants of Neurospora crassa that require supplementation with unsaturated fatty acids for optimal growth. Unlike previously described ufa mutants which cannot synthesize oleic acid, pfa mutants including pfa-4 are specifically impaired in the synthesis of polyunsaturated fatty acids such as α-linoleic or α-linolenic acid while retaining the ability to synthesize oleic acid. The pfa-4 mutant was generated using ICR-170 as a mutagen and has been mapped to chromosome VII with approximately 67% linkage (52/78) . This mutant represents a valuable tool for studying fatty acid metabolism pathways in filamentous fungi.

What is the biochemical function of Palmitoyltransferase PFA4?

Palmitoyltransferase PFA4 functions as a protein acyltransferase (PAT) that catalyzes the addition of palmitate groups to protein substrates. It belongs to the DHHC family of PATs, which are characterized by a conserved Asp-His-His-Cys motif essential for their catalytic activity. These enzymes play crucial roles in protein localization, stability, and function by mediating post-translational modifications. In experimental systems, PFA4 exhibits autopalmitoylation activity, which is thought to represent an intermediate step in the transferase reaction mechanism . The specific targets and substrate preferences of PFA4 differ from those of other PATs like Erf2/Erf4 or Pfa3, suggesting specialized physiological roles.

How does the fatty acid profile of pfa-4 mutants differ from wild-type Neurospora crassa?

The pfa-4 mutant shows distinct alterations in its fatty acid profile compared to wild-type strains. Gas chromatography analysis reveals that pfa-4 has approximately 41% palmitic acid (16:0), 24% palmitoleic acid (16:1), 18% oleic acid (18:1), and 16% linoleic acid (18:2), with negligible amounts of linolenic acid (18:3) . This distribution differs significantly from wild-type Neurospora crassa, which typically produces substantial amounts of linolenic acid. The inability to synthesize adequate levels of polyunsaturated fatty acids, particularly linolenic acid, is the primary metabolic defect in this mutant, necessitating exogenous supplementation for optimal growth.

What expression systems are recommended for producing recombinant PFA4?

Based on established protocols, both yeast and bacterial expression systems can be effectively employed for recombinant PFA4 production. For yeast expression, systems utilizing GAL promoters (GAL1 or GAL10) in strains like YPH499 have proven successful for related PAT enzymes. These systems often incorporate N-terminal tags (such as 6xHis or FLAG) to facilitate purification and detection . For bacterial expression, E. coli-based systems with T7 or tac promoters can be utilized, though membrane proteins like PATs may require optimization of growth conditions and solubilization strategies. When selecting an expression system, researchers should consider factors such as post-translational modification requirements, protein folding assistance, and downstream application needs.

What are effective methods for assessing PFA4 enzymatic activity in vitro?

Enzymatic activity of recombinant PFA4 can be assessed using radiolabeling approaches with [14C]palmitoyl-CoA or [3H]palmitoyl-CoA as substrates. In a standard in vitro assay, purified recombinant PFA4 is incubated with radiolabeled palmitoyl-CoA and potential protein substrates. The palmitoyltransferase activity can be quantified by measuring the incorporation of radioactive palmitate into the protein substrates after separation by SDS-PAGE and autoradiography . Alternative non-radioactive methods include using clickable palmitate analogs (e.g., 17-octadecynoic acid) combined with copper-catalyzed azide-alkyne cycloaddition and detection by fluorescence or western blotting. Autopalmitoylation of PFA4 itself can serve as a positive control in these assays.

How can I optimize growth conditions for pfa-4 mutant strains?

To achieve optimal growth of pfa-4 mutant strains, medium supplementation with appropriate unsaturated fatty acids is essential. Experimental evidence suggests that pfa-4 mutants grow more vigorously when supplemented with 1% (v/v) Tween 80, which contains esterified oleic acid (18:1), compared to direct supplementation with 1-5 mM concentrations of free fatty acids . For laboratory cultivation, Vogel's minimal medium supplemented with 1% Tween 80 or alternative fatty acid sources such as 0.1-0.5% (v/v) olive oil can support robust growth. Temperature optimization is also important, with 25-28°C typically being optimal for Neurospora crassa cultivation. When designing experiments with pfa-4, researchers should include appropriate wild-type controls grown under identical supplementation conditions to distinguish phenotypic effects of the mutation from those of the supplements.

How does PFA4 influence membrane composition and function in Neurospora crassa?

The pfa-4 mutation significantly alters membrane lipid composition in Neurospora crassa due to its impact on polyunsaturated fatty acid synthesis. This alteration affects membrane fluidity, permeability, and the function of membrane-associated proteins. Research indicates that phosphatidylcholine (PC) and diacylglycerol (DG) fractions show distinct patterns of fatty acid incorporation in pfa-4 mutants compared to wild-type, particularly with respect to labeling patterns after [14C]acetate administration . These changes in membrane composition have broad implications for cellular processes including signal transduction, vesicular trafficking, and response to environmental stresses such as temperature fluctuations. The specific molecular mechanisms by which PFA4 regulates membrane lipid metabolism remain an active area of investigation, with evidence suggesting roles in desaturation pathways and potential interactions with other lipid-modifying enzymes.

What is the relationship between PFA4 and other fatty acid metabolism genes in Neurospora crassa?

PFA4 functions within a complex network of genes involved in fatty acid metabolism in Neurospora crassa. Genetic analyses have shown that pfa-4 represents a distinct complementation group from other pfa mutants (pfa-1, pfa-2, pfa-3, and pfa-5), each mapping to different chromosomal locations . The interaction between PFA4 and other components of fatty acid synthesis, desaturation, and elongation pathways appears to be coordinated but not redundant, suggesting specialized roles in lipid metabolism. Unlike carnitine palmitoyltransferases, which facilitate the transport of long-chain acyl-CoA molecules into mitochondria for oxidation , the PFA4 palmitoyltransferase likely mediates protein modifications through palmitoylation. Understanding these functional relationships requires sophisticated genetic approaches such as epistasis analysis, synthetic lethality screening, and transcriptional profiling under various nutrient conditions.

How can comparative analysis between fungal PFA4 and mammalian palmitoyltransferases inform structure-function studies?

Comparative analysis of fungal PFA4 and mammalian palmitoyltransferases provides valuable insights into evolutionarily conserved features and functional specializations. While Neurospora crassa PFA4 and mammalian DHHC-domain palmitoyltransferases share the catalytic cysteine-rich domain, they exhibit differences in substrate specificity, regulatory mechanisms, and cellular localization. Structural modeling based on sequence alignments reveals conserved catalytic residues but divergent regulatory domains, which may explain the functional specialization observed between species . Researchers can leverage these comparative analyses to design targeted mutagenesis experiments, identify critical functional domains, and predict substrate interactions. Such structure-function studies contribute to our fundamental understanding of post-translational lipid modifications and may eventually inform therapeutic strategies targeting palmitoyltransferases in human disease contexts.

What are effective strategies for purifying recombinant PFA4 for biochemical studies?

Purification of recombinant PFA4 presents challenges due to its membrane-associated nature and hydrophobicity. A successful purification strategy typically involves:

  • Expression with affinity tags (6xHis or FLAG) in appropriate expression systems

  • Cell lysis under conditions that preserve protein structure and activity

  • Membrane fraction isolation by differential centrifugation

  • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC) for His-tagged proteins

  • Size exclusion chromatography to achieve higher purity

  • Concentration and storage in buffers containing stabilizing agents

For activity studies, it's essential to verify that the purified protein retains its enzymatic function, which can be assessed through autopalmitoylation assays . Stability optimization may require screening different buffer compositions, pH conditions, and additive combinations to maintain the native conformation and activity of the enzyme.

How can genetic complementation be used to validate PFA4 function in Neurospora crassa?

Genetic complementation provides a powerful approach to validate the function of PFA4 in Neurospora crassa. The process involves:

  • Cloning the wild-type PFA4 gene with its native promoter or an inducible promoter system

  • Transforming the construct into pfa-4 mutant strains using established Neurospora transformation protocols

  • Selecting transformants on media without fatty acid supplementation

  • Confirming integration of the wild-type gene by PCR or Southern blotting

  • Analyzing the fatty acid profiles of complemented strains

  • Assessing growth rates under various conditions to verify functional restoration

Successful complementation, indicated by restoration of wild-type growth and fatty acid profiles, provides strong evidence for the specific role of PFA4 in polyunsaturated fatty acid synthesis . This approach can be extended to structure-function studies by introducing specific mutations to the wild-type gene and assessing their impact on complementation efficiency.

What experimental designs are appropriate for studying PFA4 substrate specificity?

To investigate PFA4 substrate specificity, researchers can employ factorial experimental designs that systematically vary multiple factors. A 2^(k-p) fractional factorial design would be particularly suitable for efficiently exploring the effects of multiple experimental variables with a manageable number of experiments . Key factors to consider include:

  • Substrate protein characteristics (size, structure, pre-existing modifications)

  • Reaction conditions (pH, temperature, ionic strength)

  • Cofactor requirements (Zn²⁺, Mg²⁺)

  • Competitive inhibitors or enhancers

  • Palmitoyl-CoA concentration

  • Enzyme concentration

  • Reaction time

For example, a 2^(7-4) design would require only 8 experimental runs while providing valuable information about the main effects of these 7 factors. Results can be analyzed using statistical software to identify significant factors and potential interactions . This approach enables researchers to efficiently optimize reaction conditions and identify structural features that determine substrate recognition by PFA4.

How does PFA4 contribute to stress responses in Neurospora crassa?

Recent research suggests that PFA4 plays important roles in stress response pathways in Neurospora crassa. The altered membrane composition in pfa-4 mutants affects cellular resilience to various stressors, including temperature fluctuations, oxidative damage, and osmotic challenges. Under sulfur starvation conditions, changes in lipid metabolism genes, including those related to fatty acid synthesis and modification, have been observed in transcriptional profiling studies . The specific contribution of PFA4 to these responses remains to be fully elucidated, but evidence points to connections between polyunsaturated fatty acid availability and adaptation to environmental stresses. Future research directions might include comprehensive phenotypic characterization of pfa-4 mutants under various stress conditions and identification of stress-responsive proteins that undergo palmitoylation dependent on PFA4 activity.

What is known about the three-dimensional structure of PFA4 and related palmitoyltransferases?

While the complete three-dimensional structure of Neurospora crassa PFA4 has not been experimentally determined, structural information can be inferred from homology modeling based on related DHHC palmitoyltransferases. These enzymes typically contain multiple transmembrane domains with a catalytic DHHC-containing domain facing the cytosol. The catalytic mechanism is thought to involve formation of a palmitoyl-enzyme intermediate through the cysteine residue in the DHHC motif, followed by transfer to substrate proteins . Structural predictions suggest that substrate recognition involves specific protein-protein interactions distinct from the catalytic site. Recent advances in cryo-electron microscopy and membrane protein crystallography offer promising approaches for determining the actual structure of PFA4, which would significantly advance our understanding of its function and specificity.

How might PFA4 research contribute to biotechnological applications?

Research on PFA4 and related palmitoyltransferases has potential applications in biotechnology, particularly in the areas of:

  • Engineered lipid production: Manipulation of PFA4 and related genes could enable the development of Neurospora strains optimized for production of specific fatty acid profiles for industrial applications.

  • Protein modification tools: Recombinant PFA4 could serve as a biotechnological tool for site-specific lipid modification of proteins, enhancing their membrane association or stability.

  • Biosensor development: The specific substrate requirements of PFA4 might be leveraged to develop biosensors for detecting protein-lipid interactions or screening for modulators of palmitoyltransferase activity.

  • Metabolic engineering: Understanding the role of PFA4 in lipid metabolism networks could inform strategies for engineering fungal strains with enhanced production of valuable compounds derived from fatty acid precursors.

These applications remain largely theoretical at present, but the fundamental research on PFA4 establishes the knowledge foundation necessary for such biotechnological innovations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.