Recombinant Neurospora crassa Peptidyl-prolyl cis-trans isomerase B (cpr-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cpr2; 18F11.170; NCU01200; Peptidyl-prolyl cis-trans isomerase B; PPIase B; Rotamase B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-285
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
cpr2
Target Protein Sequence
AKGPKITHKVYFDIEQGDKPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRV IKQFMIQGGDFTKGDGTGGKSIYGDKFPDENFKLKHSKKGLLSMANAGKDTNGSQFFITT VITSWLDGKHVVFGEVLEGYDVVEKIENTKTGPRDAPAEPIKIAKSGELEVPPEGLEGQS EWASPAYANEDEKPAAPVPVTDAKPPAHDSIPAATADDDDTGAPLFAKVLFFGVLVLGLV LYIRLRRAPKGTYGKGME
Uniprot No.

Target Background

Function
Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Database Links

KEGG: ncr:NCU01200

Protein Families
Cyclophilin-type PPIase family, PPIase B subfamily
Subcellular Location
[Isoform Long]: Membrane; Single-pass membrane protein.; [Isoform Short]: Endoplasmic reticulum lumen.

Q&A

What is Peptidyl-prolyl cis-trans isomerase B (cpr-2) in Neurospora crassa?

Peptidyl-prolyl cis-trans isomerase B (cpr-2) in Neurospora crassa is a cyclophilin-type enzyme that catalyzes the isomerization of proline peptide (Xaa-Pro) bonds in proteins. This protein belongs to a family of enzymes that play critical roles in protein folding by accelerating the slow cis-trans isomerization of prolyl peptide bonds, which are often rate-limiting steps in the protein folding process . The mature cpr-2 protein spans amino acids 28-285 and contains conserved domains characteristic of PPIases, including binding sites for its substrates . Like other cyclophilins, cpr-2 likely binds to the immunosuppressive drug cyclosporin A (CsA), which inhibits its prolyl isomerase activity .

How is recombinant cpr-2 expressed and purified for research purposes?

Recombinant cpr-2 from Neurospora crassa is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The expression construct includes the mature protein sequence (amino acids 28-285), omitting the signal peptide. For efficient expression, researchers should:

  • Clone the cpr-2 coding sequence into a suitable expression vector (e.g., pET-based vectors)

  • Transform the construct into an E. coli expression strain (commonly BL21(DE3) or similar)

  • Induce protein expression with IPTG at optimal conditions (typically 0.5-1 mM IPTG at 18-25°C to minimize inclusion body formation)

  • Harvest cells and lyse using sonication or mechanical disruption

  • Purify using nickel affinity chromatography followed by size exclusion chromatography

After purification, the protein can be stored lyophilized or in solution with 6% trehalose in Tris/PBS buffer at pH 8.0. For long-term storage, 5-50% glycerol should be added and the protein aliquoted and stored at -20°C or -80°C to avoid repeated freeze-thaw cycles .

What are the key structural and functional domains of cpr-2?

The cpr-2 protein contains several key functional domains that are essential for its enzymatic activity as a peptidyl-prolyl isomerase:

DomainApproximate PositionFunction
N-terminal region28-50Contains targeting/localization signals
PPIase catalytic domain51-220Mediates isomerization of prolyl bonds
Cyclosporin A binding site75-160Interaction with CsA, causing inhibition
Substrate binding pocket60-140Recognition and binding of target proteins
C-terminal region221-285May mediate protein-protein interactions

The conserved amino acid residues in the catalytic domain form a hydrophobic pocket that accommodates the proline residue of the substrate . The enzyme's activity is NADPH-independent, distinguishing it from other oxidoreductases like cytochrome P450 reductases that require NADPH as a cofactor .

How can CRISPR/Cas9 systems be applied to study cpr-2 function in Neurospora crassa?

The CRISPR/Cas9 system offers a powerful approach for investigating cpr-2 function in Neurospora crassa. A user-friendly CRISPR/Cas9 system has been developed specifically for N. crassa that involves genomic integration of the cas9 gene and electroporation of naked guide RNA . To apply this system for cpr-2 research:

  • Design guide RNAs targeting specific regions of the cpr-2 gene using available software tools to ensure specificity and minimize off-target effects

  • Use a strain with genomically integrated cas9 under a suitable promoter

  • Introduce the guide RNA via electroporation

  • Screen transformants for the desired mutation

For higher efficiency, researchers can use a co-editing strategy with a selectable marker like cyclosporin-resistant-1 (csr-1). By simultaneously targeting both csr-1 and cpr-2, the probability of finding mutants with the desired cpr-2 modification increases substantially . This approach eliminates the need for constructing multiple vectors and significantly accelerates the mutagenesis process, achieving up to 100% editing efficiency under selection conditions.

What assays can be used to measure cpr-2 enzymatic activity?

Several biochemical assays can be used to measure the enzymatic activity of recombinant cpr-2:

  • Tetrapeptide isomerization assay: Using synthetic tetrapeptides containing a proline residue (e.g., Ala-Ala-Pro-Phe) and monitoring the cis-trans isomerization by HPLC or spectroscopic methods.

  • Protein folding assistance assay: Measuring the acceleration of folding of denatured RNase T1 or other model proteins in the presence of cpr-2. This assay directly demonstrates the functional role of cpr-2 in protein folding kinetics .

  • Coupled enzyme assays: In these assays, the protein disulfide isomerase (PDI) activity is measured in the presence and absence of cpr-2. The synergistic effect can be quantified by monitoring the rate of native disulfide bond formation in model substrates .

  • Cyclosporin A binding assay: Since cpr-2 likely binds to cyclosporin A, binding assays using fluorescently labeled CsA can assess the functional integrity of the recombinant protein .

When performing these assays, it's important to include appropriate controls and to optimize buffer conditions (pH, salt concentration) to ensure maximal enzymatic activity. Temperature optimization is also critical, as the thermal stability of the enzyme can significantly affect its activity.

How does cpr-2 interact with protein disulfide isomerase during oxidative protein folding?

The interaction between cpr-2 and protein disulfide isomerase (PDI) represents a critical synergy in the protein folding machinery. During oxidative protein folding, two rate-limiting processes must occur: isomerization of prolyl peptide bonds and formation of correct disulfide bridges. Research indicates these processes are interconnected in the following manner:

  • The cis-trans isomerization of proline residues catalyzed by cpr-2 must be properly coordinated with disulfide bond formation catalyzed by PDI

  • Proteins with correct prolyl isomers appear to be better substrates for PDI, enhancing its catalytic efficiency

  • The presence of cpr-2 markedly improves the efficiency of PDI as a catalyst of disulfide bond formation during oxidative folding

This functional interaction suggests that partially folded protein intermediates with native-like prolyl isomer configurations present their cysteine residues in spatial arrangements more conducive to correct disulfide bond formation. Experimental approaches to study this interaction include reconstitution experiments with purified components and folding kinetics studies using model substrates like ribonuclease T1 . This interaction likely mirrors in vivo processes in the endoplasmic reticulum where nascent proteins fold with the assistance of multiple chaperones and folding catalysts.

How can the copper-regulated promoter system be used to study cpr-2 expression and function?

The tcu-1 copper-regulated promoter system from Neurospora crassa provides an excellent tool for controlled expression of cpr-2 for functional studies. This system allows precise temporal control of gene expression through modulation of copper availability in the medium . To implement this system for cpr-2 research:

  • Generate a construct with the tcu-1 promoter (Ptcu-1) fused to the cpr-2 coding sequence

  • Integrate this construct into the N. crassa genome at a specific locus using homologous recombination or CRISPR/Cas9

  • Expression can be repressed by adding excess copper to the medium

  • Expression can be induced by copper depletion using chelators like bathocuproinedisulfonic acid (BCS)

The kinetics of induction and repression with this system are rapid, allowing for time-course studies of cpr-2 function. This approach is particularly valuable for studying the effects of cpr-2 overexpression or for creating conditional knockdowns to assess its role in various cellular processes . The system can also be used to express tagged versions of cpr-2 for protein localization or interaction studies.

What is the relationship between cpr-2 and the general amino acid control pathway in Neurospora crassa?

While direct evidence linking cpr-2 to the general amino acid control (GAAC) pathway in Neurospora crassa is limited in the provided search results, there are intriguing connections that warrant investigation. The cpc-2 gene of N. crassa (distinct from but potentially functionally related to cpr-2) is required to activate general amino acid control under conditions of amino acid limitation . This suggests potential regulatory networks involving multiple protein folding and metabolic pathways.

Hypotheses that researchers might test include:

  • Whether cpr-2 expression is regulated by amino acid availability

  • If cpr-2 function affects the folding or activity of key GAAC pathway components

  • Whether cpr-2 and cpc-2 participate in overlapping protein interaction networks

The cpc-2 gene encodes a protein with seven WD-repeats showing significant homology to G-protein beta-subunit-related polypeptides, including the receptor for activated C kinase (RACK1) . Investigating potential physical or functional interactions between cpr-2 and cpc-2 could reveal important insights into how protein folding machinery is integrated with nutrient sensing and metabolic control in N. crassa.

What approaches can be used to study the subcellular localization of cpr-2?

Understanding the subcellular localization of cpr-2 is essential for elucidating its biological functions and interaction partners. Several complementary approaches can be employed:

  • Fluorescent protein tagging: Generate constructs expressing cpr-2 fused to GFP or other fluorescent proteins under native or controlled promoters. The copper-regulated promoter system can be particularly useful for this purpose .

  • Subcellular fractionation: Isolate different cellular compartments (cytosol, microsomes, mitochondria, nucleus) using differential centrifugation and detect cpr-2 using specific antibodies.

  • Immunofluorescence microscopy: Use antibodies against cpr-2 or epitope tags to visualize its location within fixed cells.

  • Bioinformatic prediction: Analyze the cpr-2 sequence for targeting signals that might direct the protein to specific compartments. The N-terminal region often contains important localization signals, as seen in other proteins like cytochrome P450 reductases .

The N-terminal region of cpr-2 likely contains important targeting information. By comparing this region with other fungal PPIases or with the N-termini of poplar CPRs (which contain conserved sequences directing subcellular localization), researchers can generate hypotheses about cpr-2 localization that can be tested experimentally .

What are the optimal conditions for storing and handling recombinant cpr-2?

Proper storage and handling of recombinant cpr-2 is critical for maintaining its enzymatic activity. Based on established protocols:

  • The purified protein can be stored as a lyophilized powder for long-term stability

  • Upon reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage of reconstituted protein, add glycerol to a final concentration of 5-50% (50% is recommended) and store in aliquots at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity

  • Working aliquots can be stored at 4°C for up to one week

The storage buffer typically consists of a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability . Before using stored protein for enzymatic assays, it's advisable to verify its activity using standard substrates to ensure that the storage conditions have preserved its functional integrity.

How can site-directed mutagenesis be used to study the catalytic mechanism of cpr-2?

Site-directed mutagenesis represents a powerful approach for investigating the structure-function relationships of cpr-2's catalytic mechanism. To implement this strategy:

  • Identify conserved amino acid residues in the catalytic domain based on sequence alignments with other well-characterized PPIases

  • Design primers for site-directed mutagenesis targeting specific residues predicted to be involved in:

    • Substrate binding

    • Catalytic activity

    • Cyclosporin A binding

    • Protein-protein interactions

  • Generate mutant constructs using standard molecular biology techniques

  • Express and purify the mutant proteins using the same protocol as for the wild-type protein

  • Assess the impact of mutations on:

    • Enzymatic activity using standard PPIase assays

    • Protein folding assistance capability

    • Cyclosporin A binding affinity

    • Thermal stability and structural integrity

By systematically analyzing the effects of specific mutations, researchers can map the functional architecture of the enzyme and develop detailed models of its catalytic mechanism. This approach can also identify residues that might serve as targets for the development of specific inhibitors or activators of cpr-2 function.

What strategies can overcome challenges in crystallizing recombinant cpr-2 for structural studies?

Obtaining high-quality crystals of recombinant cpr-2 for X-ray crystallography can be challenging. Several strategies can enhance success:

  • Protein engineering approaches:

    • Remove flexible regions that might impede crystallization

    • Create fusion constructs with well-crystallizing proteins (e.g., lysozyme, maltose-binding protein)

    • Introduce surface mutations to reduce entropy (surface entropy reduction)

  • Expression optimization:

    • Test different expression systems (E. coli, yeast, insect cells)

    • Optimize codon usage for the expression host

    • Evaluate different purification tags and their positions (N- or C-terminal)

  • Crystallization condition screening:

    • Employ high-throughput crystallization screens covering diverse precipitants, buffers, and additives

    • Test crystallization with bound ligands or inhibitors like cyclosporin A to stabilize the protein

    • Explore crystallization at different temperatures (4°C, 16°C, 20°C)

  • Alternative structural approaches:

    • Nuclear Magnetic Resonance (NMR) spectroscopy for solution structure determination

    • Cryo-electron microscopy, particularly if cpr-2 can be studied in complex with larger protein partners

    • Small-angle X-ray scattering (SAXS) for low-resolution structural information

By combining these approaches with information about the protein's biochemical properties and stability, researchers can overcome the challenges associated with structural studies of cpr-2 and gain valuable insights into its molecular architecture and mechanism of action.

How can inconsistent enzymatic activity results for recombinant cpr-2 be reconciled?

Researchers may encounter variability in cpr-2 enzymatic activity measurements. Several factors can contribute to these inconsistencies and should be systematically addressed:

  • Protein quality issues:

    • Verify protein purity by SDS-PAGE and mass spectrometry

    • Assess protein folding using circular dichroism spectroscopy

    • Check for aggregation using dynamic light scattering or size exclusion chromatography

  • Assay conditions:

    • Optimize buffer composition, pH, and ionic strength

    • Standardize temperature control during assays

    • Ensure substrate quality and concentration consistency

    • Validate that assay is conducted within the linear range of enzyme activity

  • Enzyme stability concerns:

    • Monitor activity decay over time under assay conditions

    • Add stabilizing agents (e.g., BSA, glycerol) if appropriate

    • Pre-incubate the enzyme under assay conditions before adding substrate

  • Data analysis considerations:

    • Use appropriate kinetic models that account for substrate isomer distributions

    • Include enzyme-free controls to correct for spontaneous isomerization

    • Perform sufficient technical and biological replicates for statistical validation

By systematically addressing these factors and maintaining detailed records of experimental conditions, researchers can identify sources of variability and establish reproducible protocols for cpr-2 activity measurements.

What factors influence the efficiency of recombinant cpr-2 expression in heterologous systems?

The expression of recombinant cpr-2 in heterologous systems can be influenced by multiple factors that researchers should consider:

  • Host selection:

    • E. coli strains like BL21(DE3) are commonly used but may have limitations for proper folding

    • Yeast systems (Saccharomyces cerevisiae, Pichia pastoris) may provide better folding environments

    • Consider expression systems that have succeeded with similar proteins

  • Expression vector design:

    • Codon optimization for the host organism

    • Selection of appropriate promoter strength and inducibility

    • Inclusion of solubility-enhancing fusion tags (e.g., MBP, SUMO, Thioredoxin)

    • Inclusion of appropriate secretion signals if needed

  • Culture conditions:

    • Temperature (lower temperatures often increase soluble protein yield)

    • Induction parameters (inducer concentration, timing, duration)

    • Media composition and supplementation with cofactors

    • Cell density at induction

  • Protein extraction considerations:

    • Lysis method selection (sonication, pressure-based, detergent)

    • Buffer composition including stabilizing agents

    • Presence of appropriate protease inhibitors

When optimizing expression, a systematic approach testing combinations of these factors is recommended. Evidence from related studies indicates that co-expression with protein folding chaperones or expressing soluble domains separately may improve yields of functional protein .

What are promising research directions for understanding cpr-2's role in fungal development and stress response?

Several promising research directions could elucidate cpr-2's broader biological functions:

  • Developmental biology:

    • Investigate cpr-2's role in sexual development, as other regulatory proteins in N. crassa (like cpc-2) are known to affect protoperithecia formation

    • Examine potential functions during asexual sporulation and germination

    • Study possible involvement in hyphal development and branching patterns

  • Stress response pathways:

    • Explore cpr-2's potential role in adaptation to temperature stress

    • Investigate functions during oxidative stress conditions

    • Examine relationships with nutrient limitation responses, particularly amino acid starvation pathways

  • Interaction networks:

    • Identify cpr-2 protein interaction partners using approaches like co-immunoprecipitation coupled with mass spectrometry

    • Map genetic interactions through synthetic genetic array analysis

    • Determine whether cpr-2 functions within specific protein complexes

  • Evolutionary perspectives:

    • Conduct comparative studies of cpr-2 orthologs across fungal species

    • Investigate potential functional specialization of different cyclophilin family members in N. crassa

    • Explore how cpr-2 function may have adapted to specific ecological niches

These research directions would benefit from integrating multiple experimental approaches, including genomics, proteomics, and advanced imaging techniques, to build a comprehensive understanding of cpr-2's biological roles.

How might cpr-2 function be integrated with the CRISPR/Cas9 system for fungal biotechnology applications?

The integration of cpr-2 function with CRISPR/Cas9 technology opens exciting possibilities for fungal biotechnology:

  • Enhanced protein production platforms:

    • Engineer N. crassa strains with optimized cpr-2 expression to improve folding and secretion of recombinant proteins

    • Use CRISPR/Cas9 to create precise modifications in cpr-2 gene to enhance its activity or alter substrate specificity

    • Develop strains with conditionally regulated cpr-2 expression for proteins that might be challenging to fold

  • Synthetic biology applications:

    • Create synthetic circuits incorporating the copper-regulated promoter system to control cpr-2 expression in response to environmental cues

    • Design genetic switches that coordinate expression of cpr-2 with other protein folding factors

    • Develop reporter systems based on proteins whose folding depends on cpr-2 activity

  • Metabolic engineering strategies:

    • Use CRISPR/Cas9 to modulate cpr-2 expression in pathways where protein folding might limit metabolic flux

    • Engineer strains with modified cpr-2 that can function under industrial conditions (high temperature, extreme pH)

    • Develop screening systems for identifying optimized variants of cpr-2 for specific biotechnological applications

  • Fungal strain improvement:

    • Apply the easy-to-use CRISPR/Cas9 system developed for N. crassa to modify cpr-2 and related genes in industrial fungal strains

    • Create libraries of cpr-2 variants using CRISPR-based approaches for directed evolution

    • Develop high-throughput screening methods to identify improved strains

These approaches could significantly enhance the utility of filamentous fungi as platforms for protein production and metabolic engineering, leveraging the natural advantages of N. crassa while addressing limitations in protein folding capacity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.