Recombinant Neurospora crassa pH-response regulator protein palH/rim-21 (rim-21)

What is the structural composition of the Rim21/palH protein?

Rim21/palH is a polytopic membrane protein consisting of 778 amino acids in Neurospora crassa. The protein contains several key regions: an N-terminal extracellular domain subject to N-glycosylation, multiple transmembrane domains, and a C-terminal cytosolic region (Rim21C) that contains the sensor motif for altered lipid asymmetry . The full amino acid sequence includes characteristic hydrophobic segments that anchor it to the plasma membrane, with the sequence: MEPRQLFSDPTADPISTAGAASNALSCASFNLPEGGILQLPNGEIITLSAPAAFKPPSCNLALRSVPNIIASGGVVGGTASGTMGLKADDDSHFSDWRDPFYASTFPQCYALAATTIIAYXXXXXXXPXXFLDGGVVVLGRKGFTNGGGGTSIGGRPWLQKVAALSVAISLTIANAATFRAAEQQYSWGVQNAKQLQEDVLGGAELKIIRIISDTFLWLAQAQTLIRLFPRQREKVIIKWTAFALITLDVIFQSLNSFKYGGSDLTRPKFTEAVPALSYLFALALGVLYAAWVLYYSIMKKRYAFYHPLMKNMILVAVLSVVSILVPVVFFILDISKPDFAGWGDYVRWVGAAAASVI .

What is the function of Rim21 in fungal cellular physiology?

Rim21 functions as the primary sensor component in the Rim101 pathway, which mediates adaptation to alkaline environments in fungi. It specifically senses both external alkalization and alterations in plasma membrane lipid asymmetry . Upon activation, Rim21 initiates a signaling cascade that ultimately leads to the proteolytic activation of the Rim101 transcription factor by the calpain-like protease Rim13 . This activation results in the expression of genes required for alkaline adaptation through the repression of transcriptional repressors such as Nrg1 and Smp1 . The protein's strategic positioning in the membrane makes it an ideal environmental sensor, allowing fungi to respond promptly to changes in ambient pH conditions.

How does Rim21 interact with other components of the pH sensing machinery?

Rim21 forms a sensor complex with two other integral membrane proteins, Dfg16 and Rim9, which localize to the plasma membrane in a patchy and mutually dependent manner . The stability and plasma membrane localization of Rim21 are dependent on both Dfg16 and Rim9, as evidenced by the significant decrease in Rim21 levels in dfg16Δ and rim9Δ cells . When activated by external alkalization or altered lipid asymmetry, the C-terminal cytosolic region of Rim21 dissociates from the plasma membrane and recruits downstream components including the arrestin-like protein Rim8, the ESCRT complex, the Bro1-like protein Rim20, and the calpain-like protease Rim13 to the plasma membrane . This recruitment ultimately leads to the proteolytic activation of the transcription factor Rim101.

What post-translational modifications affect Rim21 function?

N-glycosylation is a significant post-translational modification of Rim21 that occurs at an unconventional motif located in the N-terminal extracellular region . While this modification is not essential for Rim21's ability to sense pH changes, it substantially impacts the protein's stability and membrane distribution. Research has shown that Rim21 mutant proteins lacking N-glycosylation demonstrate prolonged protein lifetime compared to wild-type Rim21 . Additionally, non-glycosylated Rim21 exhibits different biochemical fractionation profiles and solubilization properties with detergents like digitonin and Triton X-100, suggesting altered membrane microdomain associations . These findings indicate that N-glycosylation modulates Rim21's residence in specific plasma membrane microdomains with distinct lipid compositions, thereby affecting its turnover while maintaining its pH-sensing capability.

What are the optimal methods for expressing and purifying recombinant Rim21 for structural studies?

Recombinant Rim21 can be expressed as a full-length protein (1-778aa) with appropriate tags for purification and detection. Based on available protocols, the most successful approach involves expressing the protein in E. coli with an N-terminal His-tag . For optimal results, researchers should:

• Clone the full-length rim-21 gene into an expression vector with an N-terminal His-tag

• Transform the construct into an E. coli expression strain optimized for membrane proteins

• Induce expression under controlled temperature conditions (typically lower temperatures of 16-20°C)

• Lyse cells in a Tris-based buffer containing appropriate protease inhibitors

• Purify using nickel affinity chromatography followed by size exclusion chromatography

• Store the purified protein in a Tris/PBS-based buffer with 50% glycerol or 6% trehalose at pH 8.0

For long-term storage, it is recommended to aliquot the protein and store at -20°C/-80°C, avoiding repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week . When reconstituting lyophilized protein, use deionized sterile water to reach a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for stability .

How can researchers effectively study the pH-sensing mechanism of Rim21?

Investigating the pH-sensing mechanism of Rim21 requires a multi-faceted approach:

• Mutagenesis studies: Systematic mutation analysis of the extracellular and transmembrane domains can identify residues critical for pH sensing. Site-directed mutagenesis targeting charged and titratable residues is particularly valuable .

• Fluorescence-based localization: Using GFP-tagged Rim21 constructs (e.g., RIM21-2GFP) allows real-time monitoring of protein localization in response to pH changes. This technique has revealed that upon external alkalization, Rim21 is internalized and degraded .

• Pathway activation assays: The functionality of mutant Rim21 proteins can be assessed by monitoring Rim101 proteolytic processing using techniques such as Western blotting with HA-tagged Rim101 (HA-RIM101) .

• Membrane depolarization experiments: Since plasma membrane depolarization appears to be a key signal for Rim21 activation, protonophore treatments or phosphatidylserine depletion in the inner leaflet of the plasma membrane can be used to artificially trigger the pathway without external alkalization .

• Protein-protein interaction studies: Co-immunoprecipitation assays and bimolecular fluorescence complementation can elucidate how Rim21 interacts with other components of the pH-sensing machinery under different pH conditions.

These approaches collectively provide insights into the structural elements and mechanisms through which Rim21 detects and responds to ambient pH changes.

What experimental approaches are effective for studying Rim21's role in sensing lipid asymmetry?

To investigate Rim21's role in sensing plasma membrane lipid asymmetry, researchers can employ several sophisticated approaches:

• Lipid flipping assays: Using fluorescently labeled phospholipids and flippase inhibitors to artificially alter lipid asymmetry while monitoring Rim21 activation.

• Genetic manipulation of lipid transporters: Deletion or overexpression of P4-ATPases (flippases) and scramblases that maintain lipid asymmetry can help determine how specific lipid distributions affect Rim21 function .

• Specific domain analysis: The C-terminal cytosolic region of Rim21 (Rim21C) contains the sensor motif for altered lipid asymmetry. Truncation and point mutation analysis of this domain can identify specific residues involved in lipid sensing .

• Biochemical fractionation: Comparing the membrane fractionation profiles of wild-type and mutant Rim21 proteins can reveal how lipid environments affect Rim21 distribution. Research has shown that non-glycosylated Rim21 exhibits different biochemical fractionation profiles, with higher presence in heavy membrane fractions .

• Detergent solubilization assays: Differential solubilization with detergents like digitonin and Triton X-100 provides insights into Rim21's association with specific membrane microdomains. Non-glycosylated Rim21 shows altered solubilization properties, being more easily extracted with digitonin but more resistant to Triton X-100 extraction .

• Artificial membrane systems: Reconstituting Rim21 in liposomes with defined lipid compositions can help determine the specific lipid requirements for its activity.

These methods collectively allow researchers to dissect the mechanisms by which Rim21 detects alterations in plasma membrane lipid organization, complementing studies on its pH-sensing function.

What is the significance of Rim21 in fungal pathogenicity and potential antifungal targets?

Rim21 represents a promising target for antifungal drug development for several key reasons:

• Upstream regulation: Rim21 occupies the most upstream position in the Rim101 pathway, which is required for the virulence of fungal pathogens . Targeting this sensor would potentially disrupt the entire pathway.

• Surface accessibility: As a plasma membrane protein with extracellular domains, Rim21 is exposed to the cell surface, making it more accessible to potential therapeutic compounds compared to intracellular targets .

• Specificity: No genes with significant homology to fungal RIM21 have been identified in human or agricultural crop genomes, potentially reducing the risk of side effects from drugs targeting this protein .

• Environmental adaptation: Since the Rim101 pathway mediates adaptation to alkaline environments often encountered by fungal pathogens during infection, disrupting Rim21 function could impair their ability to survive in host tissues.

• Conservation among pathogenic fungi: The pH-sensing mechanism appears to be conserved among various fungal species, including pathogenic ones, suggesting that targeting Rim21 could have broad-spectrum antifungal effects.

Experimental approaches to explore this potential include screening for small molecules that specifically bind to Rim21's extracellular domains, developing peptide inhibitors that disrupt Rim21 complex formation, and testing the effect of Rim21 inhibition on fungal virulence in animal models.

How can researchers genetically manipulate Rim21 for functional studies?

Genetic manipulation of Rim21 for functional studies can be approached through several established methods:

• Site-directed mutagenesis: Point mutations can be introduced using techniques like the QuikChange site-directed mutagenesis kit. For example, the N15Q mutation in the glycosylation site has been successfully created this way .

• Fluorescent protein tagging: Rim21 can be tagged with fluorescent proteins such as GFP for localization studies. For instance, RIM21-2GFP and RIM21-N15Q-2GFP constructs have been used to track Rim21 localization in response to various stimuli .

• Epitope tagging: Adding epitope tags like HA (hemagglutinin) facilitates protein detection by Western blotting and immunoprecipitation. RIM21-HA and RIM21-N15Q-HA constructs have been employed in previous studies .

• Gene deletion and complementation: Creating rim21Δ strains followed by complementation with wild-type or mutant RIM21 allows for analysis of specific protein regions. This approach can be combined with pathway activation assays .

• Genomic integration: Linear DNA fragments containing modified RIM21 sequences can be integrated into the genomic RIM21 locus through homologous recombination. For example, linearized plasmids containing RIM21-N15Q-2GFP have been successfully integrated into the RIM21 locus .

The choice of method depends on the specific research question being addressed. For membrane protein studies, maintaining proper expression levels is crucial, so integration at the native locus is often preferred over plasmid-based expression.

What techniques are available for monitoring Rim21 activation in response to pH changes?

Monitoring Rim21 activation in response to pH changes can be accomplished through several complementary techniques:

• Proteolytic processing of Rim101: Since Rim21 activation leads to Rim101 proteolytic processing, Western blotting analysis of HA-tagged Rim101 provides an indirect but reliable readout of Rim21 activity. The appearance of a processed (shorter) form of Rim101 indicates pathway activation .

• Transcriptional reporter assays: Utilizing reporter genes under the control of Rim101-regulated promoters allows quantitative assessment of pathway activation in response to pH changes.

• Fluorescence microscopy: GFP-tagged Rim21 can be visualized to track changes in localization upon pH shifts. Active Rim21 shows internalization and eventual degradation following external alkalization .

• Biochemical fractionation: Changes in Rim21's association with membrane fractions before and after pH shifts can be monitored through differential centrifugation and membrane fractionation techniques .

• Co-immunoprecipitation assays: Rim21 activation leads to recruitment of downstream components like Rim8. Co-immunoprecipitation can detect these interactions, providing evidence of Rim21 activation.

• Protein degradation kinetics: Since activated Rim21 undergoes internalization and degradation, monitoring protein levels via Western blotting after pH shifts can indicate activation .

These methods can be combined to provide a comprehensive analysis of Rim21 activation dynamics and the subsequent signaling events in the Rim101 pathway.

How can researchers analyze the membrane microdomain association of Rim21?

Analyzing Rim21's association with membrane microdomains requires specialized techniques that examine protein-lipid interactions and membrane organization:

• Detergent resistance assays: Different detergents selectively solubilize distinct membrane microdomains. By treating membranes with detergents like digitonin or Triton X-100 and analyzing the distribution of Rim21 between soluble and insoluble fractions, researchers can gain insights into its microdomain association. Studies have shown that N-glycosylation affects Rim21's detergent solubility profile, with non-glycosylated Rim21 being more easily solubilized with digitonin but more resistant to Triton X-100 .

• Sucrose gradient centrifugation: Density gradient centrifugation of membrane preparations can separate different membrane domains based on their lipid composition and associated proteins. This technique has revealed differences in the distribution of wild-type and N-glycosylation-deficient Rim21, with the latter being more abundantly found in heavy membrane fractions .

• Super-resolution microscopy: Techniques like Structured Illumination Microscopy (SIM) or Stochastic Optical Reconstruction Microscopy (STORM) can visualize the nanoscale organization of Rim21 and its co-localization with known microdomain markers.

• Fluorescence correlation spectroscopy (FCS): This technique measures the diffusion characteristics of fluorescently labeled Rim21, providing information about its mobility and potential confinement within membrane microdomains.

• Lipid-protein crosslinking: Chemical crosslinking followed by mass spectrometry can identify specific lipids that interact with Rim21 in different membrane environments.

These approaches collectively provide a comprehensive understanding of how Rim21 associates with specific membrane microdomains and how this association is influenced by factors such as N-glycosylation and environmental conditions.

How does Rim21/palH function compare between different fungal species?

The Rim21/palH pH-sensing system shows both conservation and divergence across fungal species:

While the core function of ambient pH sensing is conserved, there are significant differences in protein interactions, regulatory mechanisms, and physiological roles. In S. cerevisiae, Rim21 has been definitively identified as the central pH sensor through transient degradation experiments that showed Rim21 depletion, but not Dfg16 or Rim9 depletion, completely suppressed the Rim101 pathway . This indicates that Rim21 is the primary sensor, while Dfg16 and Rim9 play auxiliary roles in maintaining Rim21 levels and assisting in its plasma membrane localization.

The comparative analysis of these proteins across fungal species provides valuable insights into the evolution of pH sensing mechanisms and can inform approaches for developing species-specific antifungal strategies.

What are the differences between wild-type and N-glycosylation-deficient Rim21?

N-glycosylation significantly impacts Rim21 properties while maintaining its core sensing function:

These differences suggest that N-glycosylation fine-tunes Rim21's membrane microdomain association and turnover without compromising its primary sensing function. The modification appears to modulate the residence of Rim21 in specific membrane environments with distinct lipid compositions, thereby influencing its stability and possibly its interaction with other components of the sensing machinery . This nuanced regulation might allow for more precise control of pH sensing and response under various environmental conditions.

What are the emerging technologies for studying Rim21 structure-function relationships?

Several cutting-edge technologies show promise for advancing our understanding of Rim21:

• Cryo-electron microscopy (Cryo-EM): This technique could reveal the three-dimensional structure of Rim21 alone or in complex with its interaction partners. Structural insights would clarify how conformational changes translate pH sensing into downstream signaling events.

• Single-molecule FRET (smFRET): By labeling different domains of Rim21 with fluorescent donor-acceptor pairs, researchers could monitor conformational changes in real-time as the protein responds to pH shifts or altered lipid environments.

• CRISPR-Cas9 base editing: This approach enables precise modification of individual nucleotides without double-strand breaks, allowing for efficient generation of Rim21 variants to study structure-function relationships.

• Nanodiscs and lipid cubic phase crystallization: These technologies facilitate the structural study of membrane proteins by providing a more native-like lipid environment, potentially enabling crystallization of Rim21 for X-ray diffraction studies.

• Molecular dynamics simulations: Computational approaches can model how Rim21 interacts with the lipid bilayer and how its conformation changes in response to pH alterations or membrane depolarization.

These technologies, used in combination, could provide unprecedented insights into how Rim21 functions at the molecular level as a sensor for both ambient pH and membrane lipid asymmetry.

How might understanding Rim21 function contribute to antifungal drug development?

Research on Rim21 opens several promising avenues for antifungal development:

• Structure-based drug design: As structural information becomes available, researchers can design small molecules that specifically bind to and inhibit Rim21's sensing function.

• Peptide inhibitors: Developing peptides that mimic interaction interfaces between Rim21 and other components of the sensing machinery could disrupt complex formation and signaling.

• Glycosylation modulators: Since N-glycosylation affects Rim21 properties, compounds that interfere with this modification specifically in fungi could alter Rim21 function while minimizing effects on host proteins.

• Lipid-targeting approaches: Compounds that specifically alter fungal membrane lipid organization might indirectly disrupt Rim21 function by interfering with its membrane microdomain association.

• Combination therapies: Targeting Rim21 alongside other antifungal strategies could enhance efficacy and reduce the development of resistance.