Recombinant Neurospora crassa Plasma membrane fusion protein prm-1 (prm-1)

Shipped with Ice Packs
In Stock

Description

Biological Context and Significance

Neurospora crassa serves as an excellent model organism for studying cell fusion mechanisms due to its distinctive cellular behaviors during both vegetative growth and sexual reproduction. The filamentous fungus undergoes multiple cell fusion events throughout its life cycle, making it particularly valuable for investigating the molecular machinery involved in plasma membrane merger . PRM-1 represents one of the few identified proteins directly implicated in membrane fusion events across fungal species. Initially characterized in the unicellular yeast Saccharomyces cerevisiae, PRM1 homologs have since been identified in various fungi, including N. crassa, where it demonstrates both conserved and novel functions . The study of PRM-1 contributes significantly to our understanding of fundamental cellular processes across eukaryotic organisms.

Protein Architecture and Domains

The N. crassa PRM-1 protein is characterized as a multispan transmembrane protein consisting of 764 amino acids. Its full amino acid sequence reveals a complex architecture suitable for membrane integration and interaction . The protein contains multiple transmembrane domains that anchor it within the plasma membrane, with specific regions likely involved in membrane recognition and fusion activities. As a recombinant product, the full-length protein (amino acids 1-764) can be produced with an N-terminal histidine tag to facilitate purification and experimental applications . The structural features of PRM-1 align with its functional role in membrane fusion, containing regions that likely participate in protein-protein interactions and membrane reorganization events.

Role in Cell Fusion Processes

N. crassa PRM-1 plays a crucial role in membrane merger during both vegetative and sexual cell fusion events. During vegetative growth, N. crassa exhibits unique cell fusion mechanisms between germinating spores (germlings) and between mature hyphae . PRM-1 appears to be a component of the general cell fusion machinery, mediating the final steps of plasma membrane merger after cell wall degradation . Research demonstrates that strains with PRM-1 deletions show approximately 50% reduction in both vegetative and sexual cell fusion events, indicating that while important, PRM-1 is not absolutely essential for membrane fusion to occur . This suggests the existence of redundant or compensatory mechanisms that can partially substitute for PRM-1 function during membrane fusion processes.

Sexual Development and Fertilization

Unlike its homolog in S. cerevisiae, N. crassa PRM-1 demonstrates critical functions during sexual development beyond the initial fusion event. Strains carrying a PRM-1 deletion exhibit complete sterility as either a male or female mating partner, a dominant phenotype that is not complemented in a heterokaryon with wild type strains . Crosses involving PRM-1 deletion strains are arrested early in sexual development, well before the formation of ascogenous hyphae . Interestingly, this sexual defect is not suppressed by mutations in Sad-1, a gene required for meiotic silencing of unpaired DNA (MSUD), indicating that the sterility is not due to silencing effects . These findings suggest that PRM-1 has additional roles during sexual development that occur after fertilization, potentially involving heretofore uncharacterized cell fusion events required early in sexual development .

Expression Systems and Purification

Recombinant N. crassa PRM-1 protein can be successfully expressed in Escherichia coli expression systems, providing a scalable method for producing functional protein for research applications . The recombinant production typically involves the fusion of an N-terminal histidine tag to facilitate purification through metal affinity chromatography. The resulting protein product maintains the full-length sequence (amino acids 1-764) of the native PRM-1 protein while providing advantages for isolation and experimental handling . Standard purification protocols yield protein with greater than 90% purity as determined by SDS-PAGE analysis, ensuring high-quality material for downstream applications .

Implications for Cell Fusion Research

The study of recombinant N. crassa PRM-1 provides valuable insights into fundamental cellular processes with implications beyond fungal biology. Cell-cell fusion events are essential for various developmental processes in many eukaryotic organisms, during both fertilization and vegetative cell growth . While intracellular membrane fusion mechanisms are well characterized, the molecular details of plasma membrane merger between cells remain poorly understood . The recombinant PRM-1 protein serves as an important tool for investigating these mechanisms, potentially leading to broader understanding of membrane fusion events in other organisms, including higher eukaryotes. The functional characterization of PRM-1 contributes to our understanding of cell fusion, a process with implications for fertilization, development, and tissue formation across the eukaryotic kingdom.

PRM-1 Localization and Interaction Studies

Research using green fluorescent protein (GFP) fusion constructs has provided important insights into the subcellular localization of PRM-1 during cell fusion events. In S. cerevisiae, PRM-1 initially localizes to the endoplasmic reticulum before concentrating at shmoo tips during mating, ultimately accumulating at the point of cell contact in fusion pairs . Similar studies in N. crassa using a PRM-1-GFP complemented strain have contributed to understanding PRM-1 dynamics during fungal cell fusion . These localization patterns align with PRM-1's proposed function in membrane merger, positioning it at the precise cellular locations where fusion occurs. The recombinant PRM-1 protein provides opportunities for further interaction studies to identify binding partners and regulatory mechanisms that control membrane fusion events in fungal systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
prm-1; NCU09337; Plasma membrane fusion protein prm-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-764
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
prm-1
Target Protein Sequence
MVYNEKNGGGIPPVPLSLNTATPWQNVNLHNDQQTEPQLKSHPDTDPRITPYLGLRARLS QLWFNRWTILLILVLIRVIILTANLKENLGDAKAKALSACTKVEDVGSAMASMPYYMSKG VNVMAAGSMQKAVEAMASVLKMILTGVQAIIMFVINMYIGTFACLVAAFIHGGLHVATAV VEGATKVMNDAISSITKGITDDMKSFQSAIDKARDFINSGIGLISKDIQLPTINIDSHIR DLQGIKINANGVVNGLDVLDQKIPTFDEAKNLTESALAIPFNLVKGKIDTAFSEFTIEPT IFPTAEKQALSFCSNNSFLNDFFESLITLVYKAKIAFLVVIIILALLAIFVMGYIEYRGF KRERERAARMDANAFNSQDAIYIASRRWTADGGMRLAKWWTKDTDSKNYLLIRWAFAYAT SLPALFVLSLAVAGMLSCLFQWVLLRQIEKKAPELAAQVGDFAGDVVGTLKQVSNNWANS SNAVVANMESDINSDLFGWVREATESVNNTLTVLDDQIDHALVAVFNGTVLLDTARDVVG CLIGRKIDAVQDGLTWVHDHAKVTLPRFDDDIFSAGAAQSMGSDGDLSSFLAKPGAVTTD EINEAVGKVIRSLRNGVIQEALITLGLFLTYVIVVLIGVMGALIGWATPGKTRGEGGQQF GGRPPSFHNHNGFDPALAPSNAMVGNPASPHYQNEKFGGGGGMHDVASPAYEEVVYAGRV PVGNTRELITRYPSHQRTSSYPTVESPDPMPHGDEKVPGYFTPI
Uniprot No.

Target Background

Function

Function: Involved in cell fusion during mating by stabilizing the plasma membrane fusion event.

Database Links

KEGG: ncr:NCU09337

Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of PRM-1 in Neurospora crassa?

PRM-1 in Neurospora crassa functions as a plasma membrane fusion protein that plays essential roles in both vegetative and sexual cell fusion events. Research has demonstrated that PRM-1 is part of the general cell fusion machinery, as deletion of the Prm1 gene results in approximately 50% reduction in both vegetative and sexual cell fusion events . Unlike its Saccharomyces cerevisiae homolog, N. crassa PRM-1 appears to have multiple roles during sexual development beyond simple membrane fusion, evidenced by the complete sterility observed in deletion mutants when used as either male or female mating partners .

How does PRM-1 function differ between Neurospora crassa and Saccharomyces cerevisiae?

While PRM-1 homologs in both organisms contribute to plasma membrane fusion, their functional impact differs significantly:

CharacteristicN. crassa PRM-1S. cerevisiae PRM1p
Fusion defect in deletion mutants~50% reduction~50% reduction
Impact on fertilityComplete sterilityPartial reduction
Sexual developmentBlocked early, before ascogenous hyphae formPermits some mating progression
Role in vegetative fusionEssential componentNot applicable (no vegetative fusion)

While S. cerevisiae prm1Δ mutants show only partial reduction in mating efficiency, N. crassa Δprm1 strains exhibit complete sterility as either male or female partners, indicating PRM-1 plays more extensive roles in N. crassa sexual development . This difference makes N. crassa PRM-1 particularly valuable for studying membrane fusion mechanisms that may apply across broader biological contexts.

How is PRM-1 structurally organized in the membrane?

PRM-1 is a multipass transmembrane protein that localizes to the plasma membrane. Research on the S. cerevisiae homolog indicates that PRM-1 forms covalent homodimers that are SDS-resistant and reduction-sensitive, suggesting disulfide linkages between monomers . These covalent homodimers form in the endoplasmic reticulum before trafficking to the plasma membrane, with no significant interchange occurring at the cell surface . While specific structural studies on N. crassa PRM-1 are more limited, the conservation of function suggests similar structural organization, though this represents an area requiring further investigation.

What are effective methods for producing recombinant N. crassa PRM-1 for functional studies?

Production of recombinant PRM-1 requires careful consideration of expression systems due to its multipass transmembrane nature. Based on methodologies used for similar proteins:

  • Expression System Selection: Heterologous expression in Pichia pastoris often yields better results than bacterial systems for fungal membrane proteins due to proper folding and post-translational modifications.

  • Construct Design: Epitope tagging strategies similar to those employed for S. cerevisiae PRM-1 can be adapted:

    • C-terminal GFP/myc tagging preserves functionality while enabling detection

    • Inclusion of the native promoter region (507 bp upstream) ensures proper regulation

    • Consider including the native terminator sequence to maintain expression levels

  • Purification Strategy: Membrane solubilization using 1% Triton X-100 has been effective for PRM-1 immunoprecipitation studies in S. cerevisiae and should be applicable to N. crassa PRM-1 .

When designing recombinant constructs, researchers should note that N. crassa transformation can be achieved using the "Neurospora Knockout Strain Kit" methodology with electroporation of macroconidia, as referenced in the literature .

How can researchers effectively analyze PRM-1's role in membrane fusion using mutational studies?

Mutational analysis of PRM-1 provides critical insights into structure-function relationships. Based on published approaches:

  • Site-Directed Mutagenesis: Target conserved cysteine residues to disrupt covalent dimerization. In S. cerevisiae, cysteine mutants demonstrated that covalent dimerization is essential for PRM-1 activity .

  • Functional Domain Mapping: Create chimeric proteins between different fungal PRM-1 homologs to identify domains responsible for species-specific functions.

  • Analysis of Mutant Phenotypes: Assess fusion efficiency using:

    • Germling fusion assays (vegetative fusion)

    • Mating assays (sexual fusion)

    • Quantification of pre-zygote accumulation

  • Controls: Include wild-type PRM-1-GFP constructs as positive controls and Δprm1 strains as negative controls .

When analyzing mutants, researchers should note that heterokaryon complementation tests may not rescue PRM-1 deletion phenotypes, as demonstrated in studies where wild-type complementation failed to restore fertility in N. crassa .

What experimental approaches can distinguish between PRM-1's roles in membrane fusion versus subsequent developmental processes?

Distinguishing between PRM-1's direct role in membrane fusion and its contributions to downstream developmental processes requires sophisticated experimental design:

  • Temporal Analysis: Track developmental progression in Δprm1 crosses to identify precise arrest points. N. crassa Δprm1 crosses are blocked early in sexual development, before ascogenous hyphae formation .

  • Conditional Expression: Develop strains with inducible PRM-1 expression to activate the protein at different developmental stages.

  • Cell Biological Approaches:

    • Fluorescence microscopy with membrane dyes to visualize fusion interfaces

    • Live-cell imaging to track fusion dynamics in real-time

    • Electron microscopy to examine membrane ultrastructure at fusion points

  • Genetic Interaction Analysis: Examine interactions with other fusion-related genes. Studies have shown that Δprm1 sexual defects in N. crassa are not suppressed by mutations in Sad-1, which is required for meiotic silencing of unpaired DNA, but Sad-1 mutations increased progeny in Δprm1 complemented strains .

These approaches can help differentiate between direct fusion defects and secondary developmental consequences of impaired fusion.

What are the appropriate controls when studying PRM-1 function in N. crassa?

Rigorous experimental design requires appropriate controls to accurately interpret PRM-1 function:

  • Genetic Controls:

    • Wild-type strains of both mating types

    • Δprm1 mutants (both mating types)

    • Complemented strains (Δprm1 with reintroduced PRM-1)

    • Heterokaryon controls (especially important given that heterokaryons with wild-type do not complement Δprm1 sterility)

  • Experimental Controls:

    • Positive controls for fusion (compatible wild-type strains)

    • Negative controls (known fusion-defective mutants)

    • Vector-only controls for transformation experiments

  • Quantification Approaches:

    • Count fusion events per germling/hypha interaction

    • Measure percentage of successful fusions relative to contact events

    • Assess developmental progression using standardized staging criteria

When designing experiments, researchers should note that N. crassa fusion events occur in both vegetative and sexual contexts, necessitating separate assays for each process .

How can researchers effectively distinguish between different cell fusion checkpoints when studying PRM-1?

N. crassa has multiple cell fusion checkpoints, and distinguishing PRM-1's role requires specific methodological approaches:

  • Checkpoint-Specific Assays:

    • Pre-contact checkpoint: Measure chemotropic growth and homing behaviors

    • Cell wall dissolution checkpoint: Analyze cell wall integrity during fusion

    • Membrane merger checkpoint: Assess cytoplasmic mixing using fluorescent markers

  • Genetic Approaches:

    • Epistasis analysis with genes known to act at specific checkpoints

    • Analysis with cell wall remodeling (cwr) locus mutants to differentiate from allorecognition processes

  • Microscopy Methods:

    • Fluorescence microscopy using differential markers for plasma membrane and cytoplasm

    • Time-lapse imaging to track the temporal sequence of fusion events

Research has shown that signaling molecules involved in vegetative fusion differ from those in mating cell fusion in N. crassa, suggesting that G-protein coupled receptors may function differently in these contexts .

How does PRM-1 function relate to other membrane fusion systems across eukaryotes?

Understanding PRM-1 in the broader context of membrane fusion mechanisms provides valuable evolutionary insights:

  • Comparative Analysis: While PRM-1 homologs are found only in fungal species , their function in membrane fusion represents a specialized adaptation of more general fusion mechanisms. Other eukaryotic systems use different proteins but may employ similar principles.

  • Mechanistic Parallels:

    • Like viral fusion proteins, PRM-1 likely undergoes conformational changes

    • Unlike intracellular SNARE-mediated fusion, cell-cell fusion requires coordination across two separate cells

  • Research Applications:

    • Findings from PRM-1 studies may inform understanding of mammalian cell fusion events

    • Comparative studies between fungal species with different fusion requirements can highlight key evolutionary adaptations

The evolutionary specialization of PRM-1 makes it a valuable model for understanding fundamental principles of membrane fusion that may apply across broader biological contexts .

How do allorecognition processes interact with PRM-1 function in cell fusion?

Recent research has identified interactions between cell identity recognition and fusion machinery:

  • Allorecognition Systems: N. crassa employs multiple allorecognition systems that regulate fusion between genetically different individuals. The cell wall remodeling (cwr) locus controls cell wall dissolution and subsequent fusion between cells/hyphae .

  • Checkpoint Integration:

    • Allorecognition acts at specific checkpoints in the fusion process

    • PRM-1 operates at the membrane merger stage, potentially downstream of allorecognition

  • Experimental Approach:

    • Cross-compatibility assays between different cwr haplogroups with varying PRM-1 genotypes

    • Analysis of fusion frequency between compatible versus incompatible combinations

These investigations reveal that fusion competence in N. crassa involves both the core fusion machinery (including PRM-1) and recognition systems that prevent fusion between genetically different individuals .

What novel approaches might advance understanding of PRM-1 structure-function relationships?

Several cutting-edge approaches could significantly advance PRM-1 research:

  • Structural Biology Approaches:

    • Cryo-electron microscopy of PRM-1 complexes in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Computational modeling to predict interaction interfaces

  • Advanced Imaging:

    • Super-resolution microscopy to visualize PRM-1 organization at fusion sites

    • FRET-based biosensors to detect conformational changes during fusion

  • Proteomic Analysis:

    • Proximity labeling to identify PRM-1 interaction partners

    • Phosphoproteomics to characterize post-translational modifications

These approaches would address significant knowledge gaps regarding how PRM-1 structurally facilitates membrane merger and how its multiple functions in N. crassa are coordinated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.