Recombinant Neurospora crassa Presequence translocated-associated motor subunit pam-17, mitochondrial (pam-17)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
pam17; NCU00737; Presequence translocated-associated motor subunit pam17, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
87-267
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
pam17
Target Protein Sequence
SSTRPRSDAELDANAAEAAAAAQSAAHAGEPVLDWNTFFKLRKTRRRVQLAFSVIMTLIT SGAGGAVLSTGVADAMVAQVPLEPMFAVGLMTASFGALGWLMGPAMGGMVFNALKSKYRG QMEIKEGQFFARIKKHRVDPSASSMGNPVPDFYGEKISSVAGYRQWLKDQRAFNKKRTTF V
Uniprot No.

Target Background

Function
A component of the PAM complex, essential for the ATP-dependent translocation of transit peptide-containing proteins from the inner mitochondrial membrane to the mitochondrial matrix.
Database Links

KEGG: ncr:NCU00737

Protein Families
PAM17 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pam-17 and what is its primary function in mitochondria?

Pam-17 (Presequence translocated-associated motor subunit 17) is a non-essential component of the mitochondrial protein import machinery, specifically part of the Tim23 presequence translocase-associated import motor (PAM). Its primary function involves facilitating the early stages of protein translocation across the inner mitochondrial membrane. Pam-17 is particularly involved in the posttranslational import pathway, where it assists preproteins accumulated in the cytosol to enter the mitochondria after their synthesis is complete. Experimental evidence demonstrates that deletion of PAM17 causes accumulation of precursor proteins in the cytosol, with significantly less efficient import compared to wild-type cells. For example, in wild-type cells, accumulated precursor decreased from 21.3% to 2.7% within 45 minutes, while in pam17Δ cells, the decrease was only from 28.3% to 14.9% in the same period .

How does Pam-17 interact with other components of the mitochondrial import machinery?

Pam-17 functionally interacts with multiple components of the mitochondrial import machinery, particularly showing synthetic interactions with Tim44. The relationship between these proteins appears complementary, with Pam-17 operating in early stages of translocation while Tim44 assists in later stages of transport. This creates a sequential processing system for imported proteins. Research indicates that Pam-17 is specifically recruited by the receptor Tim50 to promote the transport of precursors that are hypersensitive to membrane potential (Δψ) reductions . Additionally, Pam-17 facilitates the interaction of Ssc1 (mitochondrial Hsp70) with incoming polypeptides, working in concert with the J-protein complex Pam16-18 (Tim16-Tim14) . These interactions form a sophisticated network that ensures efficient protein import into the mitochondrial matrix.

What phenotypic effects are observed in Pam-17 deletion mutants?

Pam17 deletion (pam17Δ) produces several observable phenotypes that vary significantly depending on the experimental context:

  • In vitro protein import defects: pam17Δ mitochondria show selective import deficiencies for specific matrix-targeted precursors, particularly those sensitive to reduced membrane potential.

  • Differential precursor dependencies: Certain proteins like F1β, Pam18, and Atp14 show strong import dependence on Pam17, while others like F1α, Tim44, Atp5, and Mdj1 are only mildly affected by its absence .

  • In vivo effects: Despite clear in vitro defects, pam17Δ cells grow similarly to wild-type under most conditions, though they do accumulate some precursors such as Atp14. Additionally, Pam18 levels are drastically reduced in pam17Δ mutants .

  • Synthetic enhancement: When PAM17 deletion is combined with mutations in essential import motor genes like SSC1 and TIM44, a synthetic enhancement of the single phenotypic effects is observed, highlighting the overlapping functional cooperation between these components .

What are the optimal conditions for expressing and purifying recombinant Pam-17 protein?

The expression and purification of recombinant Pam-17 typically involves bacterial expression systems, with E. coli being the preferred host. Based on available data, recombinant Neurospora crassa Pam-17 can be expressed with tags such as His-tag for purification purposes . While the specific expression conditions may vary depending on the experimental requirements, a general protocol includes:

  • Expression vector selection: Vectors allowing N-terminal or C-terminal His-tagging are commonly used.

  • Expression parameters: Induction with IPTG (typically 0.1-1.0 mM) at lower temperatures (16-25°C) often yields better results for mitochondrial proteins.

  • Purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins, followed by size exclusion chromatography to enhance purity.

  • Storage buffer: Tris-based buffers with 50% glycerol appear suitable for maintaining protein stability .

The recombinant Neurospora crassa Pam-17 proteins commercially available are often supplied in quantities of approximately 50 μg, suggesting this is a practical yield for research applications .

How can researchers effectively assess Pam-17 function in mitochondrial protein import?

Several complementary approaches can be employed to evaluate Pam-17 function in mitochondrial protein import:

  • Posttranslational import assays: Researchers can accumulate preproteins in the cytosol by temporarily reducing the mitochondrial membrane potential with protonophores like CCCP, then monitoring subsequent import after restoring the membrane potential. This approach was effectively used to demonstrate Pam-17's role in posttranslational import, showing that wild-type cells processed accumulated precursors more efficiently than pam17Δ cells .

  • Radiolabeled precursor import: Using in vitro synthesized, radiolabeled precursors known to have differential Pam-17 dependencies (such as F1β versus F1α) can provide a quantitative assessment of import efficiency. Western blotting with antibodies against mitochondrial proteins like Mdj1 can be used to monitor processing of precursor to mature forms .

  • Membrane potential modulation: Since Pam-17 is particularly important for precursors sensitive to reduced membrane potential, importing precursors in the presence of increasing amounts of protonophores like CCCP can help identify Pam-17-dependent substrates .

  • Precursor pulling assay: Using model proteins like b2(167)Δ-DHFR with methotrexate to assess import motor function in the presence and absence of Pam-17 .

What considerations should be made when designing experiments with Pam-17 temperature-sensitive mutants?

When working with temperature-sensitive Pam-17 mutants, researchers should consider several important factors:

  • Temperature control parameters: Heat shock of Tim17 temperature-sensitive mutants has been performed at 37°C for 10 minutes in import buffer lacking NADH, ATP, CP, and CK. Following heat shock, mitochondria can be directly added to complete import buffer, with subsequent import performed at 25°C and 300 rpm .

  • Conditional expression systems: For severe mutants, galactose-controlled expression systems (pGAL) have been used successfully. This allows researchers to study mutant phenotypes by switching carbon sources .

  • Plasmid shuffling approaches: For studying severe mutants, a plasmid shuffling approach can be employed, involving transformation with plasmids containing wild-type or mutant Tim17 under native promoter and terminator regions .

  • Mitochondrial isolation timing: When isolating mitochondria from temperature-sensitive mutants, select time points at which the growth of wild-type and mutant strains remains comparable, typically under permissive conditions, with phenotype induction occurring after mitochondrial purification .

How does Pam-17 dependence correlate with precursor sensitivity to membrane potential (Δψ)?

The relationship between Pam-17 dependence and precursor sensitivity to membrane potential represents a fascinating aspect of mitochondrial import regulation. Research has revealed that:

  • Precursor-specific dependencies: Precursors show dramatically different sensitivities to reduced membrane potential that correlate with their Pam-17 dependence. Proteins highly dependent on Pam-17 (like F1β) also show hypersensitivity to reduced Δψ, while proteins less affected by Pam-17 deletion (like F1α and Tim44) maintain more efficient import at low Δψ .

  • Two distinct Δψ-driven steps: Current models suggest two separate Δψ-driven translocation steps energize precursor passage across the inner mitochondrial membrane. The Δψ- and Pam-17-dependent step appears to be distinct from the step requiring motor activity .

  • Presequence versus mature domain effects: Surprisingly, a precursor's hypersensitivity to reduced Δψ is not linked to its presequence but rather to the mature portion of the polypeptide chain. This finding challenges previous assumptions about the determinants of import efficiency .

  • Recruitment mechanism: Pam-17 is specifically recruited by the receptor Tim50 to promote transport of these hypersensitive precursors, suggesting a specialized adaptation to ensure efficient import of certain protein classes .

What is the relationship between Pam-17 and the lateral cavity mechanism of the Tim17 translocase?

Recent structural and functional analyses have revealed important insights into the Tim17 translocase mechanism and its potential relationship with Pam-17:

  • Tim17 structure and function: Rather than forming traditional channels, Tim17 contains a lateral cavity opening to the lipid bilayer. Hydrophilic residues within this cavity (such as N64 and S114) are crucial for matrix protein translocation .

  • Essential negative charges: Tim17 contains conserved negative charges (D17, D76, E126) near the intermembrane space side of the bilayer that are essential for viability and protein translocation. Mutations in these residues cause severe growth defects and import impairment .

  • Translocation model: Current models suggest that Δψ is crucial for extracting mitochondrial presequences from the inner membrane through the Tim17 lateral cavity, allowing mtHsp70 to bind to the first hydrophobic part after it emerges into the matrix .

  • Potential Pam-17 involvement: While direct interaction data is limited, Pam-17's known role in early import steps suggests it may facilitate the initial engagement of precursors with this lateral cavity mechanism, particularly for those precursors that are sensitive to reduced membrane potential .

What methodologies can differentiate between Pam-17 and mtHsp70 (Ssc1) dependencies in precursor import?

Distinguishing between Pam-17 and mtHsp70 dependencies requires sophisticated experimental approaches:

  • Temperature-conditional mutant comparison: Using temperature-conditional mtHsp70 (ssc1-3) mutants and comparing import defects with pam17Δ mutants can reveal distinct requirements. For example, after heat inactivation of mtHsp70, both F1α and F1β imports are compromised to similar extents, whereas in pam17Δ mutants, these precursors show differential dependencies .

  • Sequential inactivation experiments: Importing precursors into mitochondria where both Pam-17 and mtHsp70 function can be independently manipulated allows researchers to determine which factor acts at which stage of import.

  • Pulling force assays: Using model fusion proteins like b2(167)Δ-DHFR with methotrexate to test import motor pulling force in the presence and absence of Pam-17. Interestingly, pam17Δ mitochondria did not display a pulling defect for this model protein, suggesting Pam-17 acts before the mtHsp70-driven pulling step .

  • Synthetic genetic interaction analysis: Examining growth of double mutants (pam17Δ combined with conditional ssc1 mutants) can reveal the extent of functional overlap between these components .

What are common challenges in expressing and purifying functional Neurospora crassa Pam-17, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Neurospora crassa Pam-17:

  • Protein solubility issues: As a mitochondrial membrane-associated protein, Pam-17 may exhibit solubility problems. This can be addressed by:

    • Expressing only the soluble domains (amino acids 50-247 have been successfully expressed for Aspergillus fumigatus Pam17)

    • Using fusion tags that enhance solubility (MBP, SUMO, etc.)

    • Optimizing buffer conditions with mild detergents or higher salt concentrations

  • Protein stability concerns: Mitochondrial proteins may show reduced stability when expressed recombinantly. Stabilization approaches include:

    • Storage in glycerol-containing buffers (50% glycerol has been used successfully)

    • Addition of reducing agents to prevent oxidation

    • Maintaining appropriate pH (typically Tris-based buffers)

  • Functional activity assessment: Verifying that recombinant Pam-17 retains native function can be challenging. Strategies include:

    • Performing in vitro binding assays with known interaction partners

    • Complementation assays in pam17Δ yeast with the Neurospora protein

    • Using the recombinant protein in reconstituted systems with isolated mitochondria

How can researchers effectively distinguish between direct and indirect effects of Pam-17 deletion on protein import?

Distinguishing between direct and indirect effects of Pam-17 deletion requires careful experimental design:

  • Comparative phenotypic analysis: Compare the import defects in pam17Δ mitochondria with those observed in mutants of other import components. Differential patterns can help identify Pam-17-specific effects. For example, the defect pattern in pam17Δ resembles that seen in mitochondria with reduced Tim50 levels, suggesting functional connection .

  • Genetic complementation approaches: Reintroduce wild-type Pam-17 or specific mutants to pam17Δ cells to assess rescue of phenotypes. This can help identify which functional domains of Pam-17 are directly responsible for specific import defects.

  • Synthetic genetic interactions: The enhancement of phenotypes in double mutants (like pam17Δ combined with tim44 or ssc1 mutations) provides evidence for overlapping functional roles .

  • Timing of effect analysis: Analyze whether import defects manifest at early or late stages of translocation. Pam-17 is involved in early stages of import, so defects occurring later in the process are likely indirect consequences .

  • In vivo versus in vitro assessment: The apparent discrepancy between stronger in vitro defects compared to milder in vivo phenotypes in pam17Δ cells suggests compensatory mechanisms exist in living cells. Careful comparison of these contexts can help distinguish primary from secondary effects .

What are promising areas for further investigation of Pam-17 function in mitochondrial biogenesis?

Several promising research avenues could advance our understanding of Pam-17:

  • Structural characterization: Obtaining high-resolution structures of Pam-17 alone and in complex with other PAM components would significantly enhance our understanding of its molecular function. Cryo-EM approaches similar to those used for Tim17 and Tim22 could be particularly informative .

  • Substrate specificity determinants: Further investigation into why certain precursors show strong Pam-17 dependency while others don't could reveal important insights into the principles governing mitochondrial protein import. Particularly interesting is the finding that Pam-17 dependency relates to the mature portion of precursors rather than presequences .

  • Regulatory mechanisms: Exploring how Pam-17 activity is regulated in response to cellular conditions could reveal new layers of control in mitochondrial biogenesis. The specific recruitment of Pam-17 by Tim50 suggests regulatory potential .

  • Cross-species comparative studies: Expanding studies to include Pam-17 from diverse species beyond Saccharomyces cerevisiae, Neurospora crassa, and Aspergillus fumigatus could reveal evolutionarily conserved functions and species-specific adaptations.

  • Therapeutic implications: Investigating whether human Pam-17 dysfunction contributes to mitochondrial disorders could open avenues for therapeutic intervention in mitochondrial diseases.

How might advanced techniques like cryo-EM and in situ crosslinking enhance our understanding of Pam-17's structural interactions?

Advanced structural and interaction analysis techniques offer powerful approaches for elucidating Pam-17 function:

  • Cryo-EM application: Recent advances in cryo-EM have revolutionized our understanding of membrane protein complexes. Applied to the TIM23/PAM complex, this technique could reveal:

    • The precise positioning of Pam-17 relative to the lateral cavity of Tim17

    • Conformational changes during different stages of precursor translocation

    • How Pam-17 interfaces with Tim50 and other import components

  • In situ crosslinking approaches: Site-specific crosslinking along the lateral cavity of Tim17, as demonstrated in recent studies, could be extended to map Pam-17 interactions:

    • Chemical crosslinkers could capture transient interactions during import

    • Photo-activatable unnatural amino acids could provide residue-level precision

    • BPA (p-benzoyl-l-phenylalanine) has been successfully used for studying Tim17 interactions and could be applied to Pam-17

  • Oxidation studies: In vitro oxidation with reagents like 4-DPS (4,4'-dipyridyl disulfide) followed by analysis under reducing/non-reducing conditions has helped characterize Tim17 and could be applied to understand Pam-17's redox-sensitive interactions .

What is the current consensus on Pam-17's role in mitochondrial protein import, and what key questions remain?

The current scientific consensus holds that Pam-17 serves a specialized role in the early stages of mitochondrial protein import, particularly for precursors that are sensitive to reduced membrane potential. Pam-17 is recruited by Tim50 and facilitates an early, membrane potential-dependent step that occurs before the mtHsp70-driven import motor exerts its pulling force. Its function appears complementary to Tim44, which operates at a later stage of translocation.

Despite these advances, several critical questions remain:

  • Molecular mechanism: Precisely how does Pam-17 facilitate the early stages of translocation at the molecular level? Does it directly interact with precursors or primarily influence the conformation of the Tim17/23 channel?

  • Substrate specificity: What features in the mature domain of precursors determine Pam-17 dependency? Is there a specific structural or sequence motif that can predict this requirement?

  • Regulatory integration: How is Pam-17 function integrated with other regulatory mechanisms controlling mitochondrial protein import in response to cellular conditions?

  • Species-specific adaptations: Do Pam-17 proteins from different species (like Neurospora crassa versus Saccharomyces cerevisiae) exhibit functional differences reflecting adaptation to different cellular environments?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.