Recombinant Neurospora crassa Probable C-5 sterol desaturase (NCU06207)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

NCU06207 encodes a transmembrane protein with four to five membrane-spanning regions, characteristic of sterol desaturases . The recombinant version retains this structural integrity, with a His-tag appended for purification . Key features include:

PropertyDetail
Gene locusNCU06207
Protein lengthFull-length (1–344 amino acids)
Molecular weight~37.5 kDa (predicted)
TagN-terminal His-tag
Subcellular localizationEndoplasmic reticulum (inferred from homologs)

The enzyme catalyzes the Δ5(6)-desaturation of episterol to ergosterol, introducing a critical double bond in the B-ring of sterols . This reaction is essential for maintaining membrane fluidity and permeability in fungi.

Production and Biochemical Characteristics

The recombinant enzyme is produced in E. coli and purified via affinity chromatography. Key production parameters include:

ParameterSpecification
HostE. coli
Purity>90% (SDS-PAGE)
Storage bufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Functional assays confirm its activity in converting episterol to ergosterol, though specific kinetic parameters (e.g., K<sub>m</sub>, V<sub>max</sub>) remain unpublished .

Role in Ergosterol Biosynthesis

NCU06207 is part of the ergosterol biosynthesis pathway, working redundantly with ERG-10a/ERG-10b in N. crassa . Its deletion leads to accumulation of ergosta-7,22-dienol and defective plasma membrane fusion during spore germination .

StrainSterol ProfilePhenotype
Wild typeErgosterol predominantNormal membrane fusion
ΔNCU06207Ergosta-7,22-dienol accumulationImpaired plasma membrane fusion

Transcriptional Responses

Deletion of NCU06207 triggers upregulation of ergosterol biosynthesis genes (e.g., erg2, erg5) and efflux pumps like cdr4, even without antifungal stress . This suggests sterol intermediates act as signaling molecules.

Applications in Research

  1. Antifungal Drug Development:

    • Studies on NCU06207-deficient mutants reveal hypersensitivity to azoles (e.g., ketoconazole), highlighting its role in antifungal resistance .

  2. Membrane Biology:

    • Used to study sterol-dependent membrane fusion and lipid raft organization .

  3. Enzyme Engineering:

    • Recombinant NCU06207 aids in structural studies of sterol desaturases and their catalytic mechanisms .

Comparative Analysis of NCU06207 Homologs

OrganismEnzymeFunctionKey Difference
N. crassaNCU06207Ergosterol biosynthesisRedundant with ERG-10a/ERG-10b
S. cerevisiaeERG3Ergosterol biosynthesisSingle-copy gene; no redundancy
H. sapiensLathosterol oxidaseCholesterol biosynthesisUses NADPH instead of NADH

Challenges and Future Directions

  • Structural Insights: Crystallographic studies of NCU06207 are needed to elucidate its iron-dependent catalytic mechanism .

  • Therapeutic Targets: Exploiting NCU06207 for antifungal development requires overcoming redundancy in N. crassa .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
NCU06207; Probable Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
NCU06207
Target Protein Sequence
MDVVLEVTDQFMFDYMYAWLLPARPALYDFPDKTNGTAQAFSSWVYEPATKFFSLEPSQA AYQSIWTRDNIYRQALSLFLILWLFGLVTYYVFASLSYIFVFDKKTMEHPKFLKNQVWLE IKQTNAALPVMAFFTFPFLVAEVRGYSLLYDTTAEGPGRWYDFFQFPLFIMFTDFGIYWI HRGLHHPLVYKHLHKPHHKWIMPTPYASHAFHPIDGFAQSIPYHIFPFIFPLQKMAYVGL FVFINFWTIMIHDGEYYANNPVINGAACHSVHHFAFNYNYGQFTTLWDRLGGSYREPDGD MFAKEKKMSTTTWKKQVNEMEKIVKEVEGEDDRLYEPTETKKSK
Uniprot No.

Target Background

Function
Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. This enzyme potentially plays a role in regulating ergosterol biosynthesis.
Database Links

KEGG: ncr:NCU06207

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the function of Neurospora crassa C-5 sterol desaturase (NCU06207)?

NCU06207 encodes a C-5 sterol desaturase (also known as ERG-10a) that catalyzes the introduction of a double bond between C-5 and C-6 of the B ring in the sterol molecule during ergosterol biosynthesis . This enzyme is crucial for the conversion of ergosta-7,22-dienol to ergosterol, which is the predominant sterol in fungal membranes . The protein functions within the ergosterol biosynthetic pathway, which is essential for maintaining proper membrane structure and function in Neurospora crassa.

What are the alternative designations for NCU06207?

The enzyme encoded by NCU06207 is identified by several alternative names and identifiers in scientific literature:

  • ERG-10a (primary functional designation in N. crassa)

  • erg3 (ergosterol biosynthesis pathway designation)

  • Probable Delta(7)-sterol 5(6)-desaturase

  • Ergosterol Delta(5,6) desaturase

  • Sterol-C5-desaturase

  • UniProt ID: Q7SBB6

These multiple designations reflect the enzyme's characterization across different research contexts and nomenclature systems.

How does NCU06207 relate to antifungal sensitivity?

While NCU06207 itself is not the primary target of azole antifungals (which typically target ERG11/lanosterol 14α-demethylase), its expression is modulated in response to antifungal treatment. Transcriptomic analysis shows that while some ergosterol pathway genes like erg11, erg6, erg2, and erg5 are significantly upregulated in response to ketoconazole treatment, the expression of NCU06207 (erg3) shows more modest changes:

LocusGeneFunctionTPM-wt1TPM-wt(k)1Fold [wt(k)1/wt1]TPM-wt2TPM-wt(k)2Fold [wt(k)2/wt2]
NCU06207erg3C-5 sterol desaturase1000.3767.00.77639.5999.01.56

This data suggests that while NCU06207 is involved in the cellular response to antifungal stress, it is not among the most dramatically regulated genes in this pathway.

How can functional redundancy between C-5 sterol desaturases be analyzed experimentally?

Investigating functional redundancy between NCU06207 (ERG-10a) and NCU04983 (ERG-10b) requires careful experimental design:

  • Generate single deletion mutants (Δerg-10a and Δerg-10b) and double deletion mutants (Δerg-10aerg-10b) using homologous recombination techniques.

  • Phenotypically characterize each mutant, comparing growth rates, morphology, and development.

  • Analyze sterol profiles using gas chromatography-mass spectrometry (GC-MS) to confirm accumulation of ergosta-7,22-dienol in the double mutant.

  • Perform complementation assays by reintroducing either gene into the double mutant to confirm restoration of wildtype phenotype.

  • Test sensitivity to polyene antifungals, such as nystatin, as resistance indicates altered ergosterol content.

Research has demonstrated that single gene knockouts of either NCU06207 or NCU04983 produce strains that are "macroscopically indistinguishable from the WT reference strain," while the double mutant shows "a strong decrease in asexual spore differentiation" and accumulates "a brownish pigment" . This confirms their functional redundancy in N. crassa.

What methodology is recommended for producing recombinant NCU06207 protein?

For producing recombinant NCU06207 protein:

  • Clone the full-length coding sequence (1-344aa) into an expression vector with an N-terminal His-tag.

  • Transform the construct into E. coli expression strain.

  • Induce protein expression under optimized conditions.

  • Lyse cells and purify the protein using nickel affinity chromatography.

  • Dialyze against an appropriate buffer and lyophilize for storage.

The recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein activity.

How can membrane fusion defects in C-5 sterol desaturase mutants be investigated?

To investigate membrane fusion defects in C-5 sterol desaturase mutants:

  • Generate fluorescently labeled strains by transforming Δerg-10aerg-10b mutants with plasmids expressing cytosolic GFP or mCherry (e.g., pMF272 and pMFcherry) .

  • Culture cells under conditions that promote germling fusion.

  • Use live-cell imaging to observe and quantify fusion events between germlings.

  • Compare fusion efficiency between wildtype, single mutants, and double mutants.

  • Analyze membrane properties using fluorescent lipophilic dyes to evaluate membrane fluidity and organization.

Research has shown that the Δerg-10aerg-10b double mutant exhibits specific defects in plasma membrane fusion while maintaining normal hyphal growth . This approach allows for the mechanistic understanding of how the C-5/C-6 double bond in ergosterol specifically impacts membrane fusion events.

What approaches can distinguish the specific roles of the C-5/C-6 double bond from other structural features of ergosterol?

To distinguish the specific roles of the C-5/C-6 double bond:

  • Employ a comprehensive ergosterol biosynthesis mutant collection targeting different steps in the pathway.

  • Compare phenotypes across mutants accumulating different sterol intermediates.

  • Perform chemical complementation by supplementing cultures with purified sterols containing specific modifications.

  • Conduct detailed lipidomic analysis to identify any compensatory changes in other membrane lipids.

  • Utilize molecular dynamics simulations to predict how the absence of specific double bonds affects membrane properties.

Studies have shown that the membrane fusion defect observed in Δerg-10aerg-10b mutants is "unique among all of the N. crassa ergosterol biosynthesis mutants tested," suggesting that this phenotype "correlates with specific structural features of the sterol precursor formed by this mutant" . This indicates that the C-5/C-6 double bond plays a distinct role in membrane function compared to other ergosterol structural features.

How does antifungal response relate to C-5 sterol desaturase expression patterns?

To investigate relationships between antifungal responses and C-5 sterol desaturase expression:

  • Design a time-course experiment exposing N. crassa to sub-lethal concentrations of various antifungals.

  • Extract RNA and perform quantitative RT-PCR or RNA-seq to measure expression changes of NCU06207 and related genes.

  • Compare expression patterns across different antifungal classes (azoles, polyenes, echinocandins).

  • Perform ChIP-seq to identify transcription factors regulating NCU06207 expression under antifungal stress.

  • Create reporter constructs with the NCU06207 promoter to visualize expression changes in vivo.

Transcriptomic analysis shows variable responses of NCU06207 to ketoconazole treatment, with a slight downregulation (0.77-fold) in one experiment and moderate upregulation (1.56-fold) in another . This contrasts with the dramatic upregulation of other ergosterol pathway genes like erg6 (33.20-fold and 9.06-fold) , suggesting complex regulatory mechanisms that warrant further investigation.

What controls should be included when characterizing NCU06207 function?

For robust characterization of NCU06207 function, include these controls:

  • Wild-type N. crassa strain (positive control for normal ergosterol biosynthesis).

  • Single deletion mutants of NCU06207 and NCU04983 (to account for redundancy).

  • Double deletion mutant complemented with either NCU06207 or NCU04983 (to confirm specificity).

  • Treatment with a known C-5 sterol desaturase inhibitor as a chemical knockout control.

  • Expression of a catalytically inactive point mutant of NCU06207 (to distinguish structural from enzymatic roles).

The complementation approach has proven effective, as "reintegration of either the erg-10a or erg-10b gene into the double mutant restored the WT phenotype, confirming the redundant functions of the encoded enzymes" .

How can the functional relationships between C-5 sterol desaturase and other ergosterol pathway enzymes be determined?

To determine functional relationships between pathway components:

  • Create double and triple mutants combining NCU06207 deletion with mutations in other ergosterol pathway genes.

  • Analyze epistatic relationships by determining which phenotypes are dominant.

  • Perform metabolic profiling to track sterol intermediate accumulation in various mutant combinations.

  • Use protein-protein interaction studies (co-immunoprecipitation, proximity labeling) to identify physical interactions.

  • Employ systems biology approaches to model flux through the ergosterol pathway under different mutant conditions.

The analysis of such relationships is particularly important given that seven ergosterol biosynthesis genes are upregulated and four are downregulated in response to ketoconazole treatment , suggesting complex regulatory networks.

What methodologies are optimal for studying the impact of sterol composition on membrane properties?

To study how sterol composition affects membrane properties:

  • Utilize fluorescence anisotropy with membrane probes to measure membrane fluidity in different mutant backgrounds.

  • Employ atomic force microscopy to analyze membrane nanomechanical properties.

  • Perform detergent resistance assays to evaluate membrane domain stability.

  • Use fluorescence recovery after photobleaching (FRAP) to assess lateral diffusion of membrane proteins.

  • Conduct electrophysiological measurements to evaluate membrane permeability.

These approaches are valuable since the Δerg-10aerg-10b double mutant shows "a membrane fusion defect... unique among all of the N. crassa ergosterol biosynthesis mutants tested" , indicating that specific membrane properties are affected by the absence of the C-5/C-6 double bond.

How can issues with recombinant NCU06207 protein solubility and activity be addressed?

When facing solubility or activity issues with recombinant NCU06207:

  • Optimize expression conditions by testing different temperatures, induction times, and inducer concentrations.

  • Consider using solubility-enhancing fusion partners (MBP, SUMO, TrxA) instead of just a His-tag.

  • Test different detergents for membrane protein extraction (DDM, LDAO, Triton X-100).

  • Include stabilizing cofactors or substrate analogs during purification.

  • Reconstitute the purified protein in liposomes to provide a membrane-like environment.

For storage, follow established protocols: "Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles." Use "Tris/PBS-based buffer, 6% Trehalose, pH 8.0" as storage buffer .

What strategies can overcome challenges in phenotypic analysis of C-5 sterol desaturase mutants?

To address challenges in phenotypic characterization:

  • Conduct analyses across multiple developmental stages, as defects may be stage-specific.

  • Test growth under various stress conditions (oxidative, osmotic, temperature) to reveal conditional phenotypes.

  • Quantify specific developmental processes (germination rates, branching frequency, fusion efficiency) rather than relying on general growth measurements.

  • Use time-lapse microscopy to capture dynamic processes that might be missed in endpoint assays.

  • Employ metabolomic approaches to identify metabolic consequences beyond sterol profiles.

How might advanced genetic approaches further elucidate C-5 sterol desaturase function?

Advanced genetic approaches that could advance understanding of NCU06207 function include:

  • CRISPR-Cas9 gene editing to create point mutations targeting specific functional domains.

  • Conditional expression systems to study the immediate effects of enzyme depletion.

  • Synthetic genetic array analysis to systematically identify genetic interactions.

  • Targeted protein degradation approaches (e.g., auxin-inducible degron) to achieve rapid protein depletion.

  • Chromatin immunoprecipitation sequencing (ChIP-seq) to identify transcription factors regulating NCU06207 expression.

These approaches could help resolve whether the nd+ allele, which impacts mitochondrial DNA stability, "codes for a component of the complex of proteins that catalyzes recombination, and possibly repair and replication, of the mitochondrial chromosome" and whether this relates to sterol metabolism.

What comparative genomic approaches could reveal evolutionary insights about fungal C-5 sterol desaturases?

To investigate evolutionary aspects of C-5 sterol desaturases:

  • Perform phylogenetic analysis of C-5 sterol desaturases across the fungal kingdom.

  • Compare gene synteny to identify conservation of genomic context.

  • Analyze selection pressures (dN/dS ratios) on different protein domains.

  • Conduct cross-species complementation experiments to test functional conservation.

  • Investigate the distribution of gene duplications (like the ERG-10a/ERG-10b pair) across fungal lineages.

Such approaches could provide insights into why "ERG5 homologs are highly conserved in fungal kingdom" and explain the evolutionary pressures that led to the functional redundancy observed between NCU06207 and NCU04983 in N. crassa.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.