Recombinant Neurospora crassa Probable cytochrome b5 (B23L21.190, NCU03910)

Shipped with Ice Packs
In Stock

Description

General Information

Cytochrome b5 is typically found in the endoplasmic reticulum and the outer mitochondrial membrane . The heme-binding domain faces the cytosol, while the charged C-terminus resides in the organellar matrix or the mitochondrial intermembrane space .

Neurospora crassa and Cytochrome b5

Neurospora crassa is a filamentous fungus extensively used in genetic and biochemical research. Studies have identified and manipulated various N. crassa genes to understand their roles in different cellular processes .

Cytochrome b5 in Giardia intestinalis

Research on the anaerobic intestinal pathogen Giardia intestinalis shows that it incorporates heme into cytosolic cytochrome b5 . Giardia lacks the enzymes for heme synthesis and the typical hemoproteins, but it possesses several cytochrome b5-like proteins (gCYTb5) . These proteins have unconventional N- and C-terminal sequences flanking their conserved heme-binding domains .

Role in Furfural Tolerance

In Neurospora crassa, cytochrome b5 (NCU08060) is among the genes that show increased expression levels upon exposure to furfural, a toxic compound . Specifically, the "oxidation-reduction process" Gene Ontology (GO) term, which includes 53 genes, is significantly affected by furfural exposure . These genes include cytochrome b5 and other enzymes involved in various metabolic processes .

Cytochrome b5 Reductase

Cytochrome b5 reductase is an enzyme that interacts with cytochrome b5. Recombinant Neurospora crassa NADH-cytochrome b5 reductase 1 (cbr-1) can be produced in E. coli .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
B23L21.190; NCU03910; Probable cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
B23L21.190
Target Protein Sequence
MSAEFTYQDVAEHNTKKDLYVVIHDKVYDITKFVDEHPGGEEVLLDVAGQDSTEAFEDVG HSDEAREALEPLLVGTLKRQAGDPKPKAPLPSSLAPAAQTGTATGLGIGLYAVLVLGGLA GFAAYQYLQAQQGATAPSA
Uniprot No.

Target Background

Function

Function: Membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases.

Database Links

KEGG: ncr:NCU03910

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

How does Neurospora crassa cytochrome b5 compare structurally to cytochrome b5 proteins in other organisms?

While the specific structural comparisons aren't directly addressed in the available data, we can infer that Neurospora crassa cytochrome b5 likely shares core structural features with cytochrome b5 proteins from other organisms. In Giardia intestinalis, for example, cytochrome b5 proteins exhibit characteristic heme-binding properties, but some paralogs (like gCYTb5-IV) possess unusual N-terminal extensions and highly charged terminal sequences that influence their subcellular localization . Analysis of Neurospora crassa cytochrome b5 would require similar structural studies to identify unique features that distinguish it from cytochrome b5 proteins in other fungi.

What are the optimal conditions for expression and purification of recombinant Neurospora crassa cytochrome b5?

Based on available information, E. coli appears to be an effective expression system for producing recombinant cytochrome b5 proteins, including those from Neurospora crassa. The protein can be expressed with various tags (determined during the production process), with a His-tag being commonly used for similar proteins . For storage and stability, the recombinant protein should be maintained in a Tris-based buffer with 50% glycerol at -20°C/-80°C for extended storage, with working aliquots at 4°C for up to one week . Repeated freezing and thawing should be avoided to maintain protein integrity .

How can proper folding and heme incorporation be verified in recombinant Neurospora crassa cytochrome b5?

UV-visible spectroscopy is the primary method for confirming heme incorporation into cytochrome b5 proteins. Properly folded, heme-loaded cytochrome b5 exhibits characteristic UV-visible spectra distinct from the apo-protein . For Neurospora crassa cytochrome b5, spectroscopic analysis would likely reveal similar characteristic absorbance patterns when heme is successfully incorporated. Additionally, electrochemical methods could be employed to assess the redox properties of the heme-loaded protein, providing further confirmation of functional incorporation.

What experimental approaches can be used to study the interaction between Neurospora crassa cytochrome b5 and potential redox partners?

Several experimental approaches can be employed to study protein-protein interactions between Neurospora crassa cytochrome b5 and its redox partners:

  • Co-immunoprecipitation with NADH-cytochrome b5 reductase 1, which is a likely interaction partner based on information about related systems

  • In vitro reconstitution of electron transfer activities using purified components

  • Spectroscopic methods to monitor electron transfer rates

  • Yeast two-hybrid screening to identify novel interaction partners

  • Cross-linking experiments followed by mass spectrometry

In Giardia intestinalis, cytochrome b5 interacts with NADPH-dependent oxidoreductases like GiOR-1 , suggesting that similar interactions might occur in Neurospora crassa.

How can site-directed mutagenesis be utilized to investigate the heme-binding mechanism of Neurospora crassa cytochrome b5?

Site-directed mutagenesis provides a powerful approach for investigating the structure-function relationships of Neurospora crassa cytochrome b5, particularly regarding its heme-binding mechanism. Based on research with other cytochrome b5 proteins, targeted mutations of conserved residues in the heme-binding pocket can disrupt heme incorporation and electron transfer capabilities .

A methodological approach would include:

  • Identifying conserved histidine residues likely involved in coordinating the heme iron

  • Creating point mutations at these residues using PCR-based mutagenesis

  • Expressing and purifying the mutant proteins

  • Assessing heme binding using UV-visible spectroscopy

  • Measuring the functional consequences of these mutations on electron transfer activities

In Giardia intestinalis, expression of cytochrome b5 with a mutated heme-binding site failed to increase import of extracellular heme, demonstrating the effectiveness of this approach .

What is the potential role of Neurospora crassa cytochrome b5 in cellular redox homeostasis?

While the specific role of Neurospora crassa cytochrome b5 in redox homeostasis isn't directly addressed in the available data, we can infer potential functions based on knowledge of cytochrome b5 proteins in other systems. As an electron transfer protein, cytochrome b5 likely participates in multiple redox pathways that maintain cellular redox balance. It may function alongside NADH-cytochrome b5 reductase 1 in electron transfer chains that support various metabolic processes.

The protein might also contribute to defense against oxidative stress, similar to flavohemoglobin in Giardia intestinalis, which protects against oxygen and nitric oxide toxicity . Further research using knockout or knockdown approaches would be needed to determine the specific contributions of cytochrome b5 to redox homeostasis in Neurospora crassa.

How does membrane localization affect the function of Neurospora crassa cytochrome b5?

The subcellular localization significantly impacts function by determining which redox partners the protein can interact with. For instance, the Oxa2 protein in Neurospora crassa plays a critical role in inserting proteins into mitochondrial membranes , and similar protein transport mechanisms might influence cytochrome b5 localization. Experimental approaches to determine localization could include fluorescent protein tagging, subcellular fractionation, and immunolocalization studies.

What is the relationship between cytochrome b5 and other cytochrome proteins in Neurospora crassa electron transport systems?

Neurospora crassa contains multiple cytochrome proteins that function in electron transport systems, including cytochrome c and cytochrome b5. The mi-1 (poky) mutant of Neurospora crassa shows abnormal excess of cytochrome c while lacking cytochromes a and b , suggesting coordinated regulation of these proteins. Cytochrome b5 likely functions alongside NADH-cytochrome b5 reductase 1 in electron transfer pathways distinct from those involving cytochrome c.

A comprehensive understanding of these relationships would require:

  • Comparative analysis of expression patterns

  • Characterization of electron transfer rates between components

  • Investigation of regulatory mechanisms controlling cytochrome expression

  • Functional reconstitution of electron transfer systems in vitro

How might post-translational modifications affect the activity of Neurospora crassa cytochrome b5?

While the available data doesn't specifically address post-translational modifications of Neurospora crassa cytochrome b5, such modifications could significantly impact protein function. Potential post-translational modifications might include:

  • Phosphorylation of serine, threonine, or tyrosine residues, which could alter protein-protein interactions or enzyme activity

  • Acetylation of lysine residues, potentially affecting protein stability or localization

  • Ubiquitination, which might regulate protein turnover

  • Glycosylation, which could influence protein folding or stability

Experimental approaches to investigate these modifications would include mass spectrometry-based proteomics, site-directed mutagenesis of modified residues, and functional assays comparing modified and unmodified forms of the protein.

What experimental systems can be developed to study electron transfer kinetics of Neurospora crassa cytochrome b5 in vitro?

To study electron transfer kinetics of Neurospora crassa cytochrome b5 in vitro, several experimental systems could be developed:

  • Reconstituted protein systems combining purified cytochrome b5 with potential redox partners like NADH-cytochrome b5 reductase 1

  • Electrochemical cells to measure electron transfer rates under controlled potential

  • Stopped-flow spectroscopy to monitor rapid electron transfer reactions

  • Surface plasmon resonance to study binding kinetics between cytochrome b5 and its redox partners

  • Proteoliposomes incorporating cytochrome b5 to mimic the native membrane environment

These approaches would provide insights into the fundamental mechanisms of electron transfer mediated by cytochrome b5 and its interactions with physiological electron donors and acceptors.

How does the heme incorporation mechanism in Neurospora crassa cytochrome b5 compare to that in other eukaryotes?

The mechanism of heme incorporation in Neurospora crassa cytochrome b5 likely shares fundamental features with other eukaryotic cytochrome b5 proteins, though specific details aren't provided in the available data. In Giardia intestinalis, recombinant cytochrome b5 proteins expressed in E. coli successfully incorporated heme, and expression in G. intestinalis increased import of extracellular heme . This suggests conservation of basic heme-binding mechanisms across diverse eukaryotes.

The process typically involves:

  • Coordination of the heme iron by conserved histidine residues

  • Stabilization of the porphyrin ring through hydrophobic interactions

  • Possible involvement of chaperone proteins in facilitating proper folding and heme insertion

Spectroscopic and structural studies would be needed to determine whether Neurospora crassa cytochrome b5 exhibits unique features in its heme-binding mechanism compared to other eukaryotes.

What functional differences exist between cytochrome b5 proteins from Neurospora crassa and bacterial cytochrome b5 systems?

  • Eukaryotic cytochrome b5 proteins often contain membrane-anchoring domains, whereas bacterial homologs may be soluble

  • The electron transfer partners differ between fungal and bacterial systems

  • Regulation of expression and activity likely involves distinct mechanisms

  • Subcellular localization in eukaryotes provides compartmentalization not present in bacterial systems

Experimental approaches to investigate these differences would include comparative biochemical characterization, heterologous expression studies, and functional complementation experiments between fungal and bacterial systems.

What strategies can overcome challenges in achieving proper heme incorporation during recombinant expression of Neurospora crassa cytochrome b5?

Several strategies can be employed to enhance heme incorporation during recombinant expression:

  • Co-expression with heme biosynthesis enzymes to increase intracellular heme availability

  • Supplementation of growth media with δ-aminolevulinic acid (a heme precursor) or hemin

  • Optimization of expression conditions (temperature, induction timing, oxygen levels)

  • Use of specialized E. coli strains with enhanced capacity for heme protein production

  • Co-expression with molecular chaperones to facilitate proper folding

The effectiveness of these strategies would need to be empirically determined for Neurospora crassa cytochrome b5, as the optimal approach may differ from that used for other heme proteins.

How can researchers assess and improve the stability of purified Neurospora crassa cytochrome b5?

Based on the storage recommendations for recombinant Neurospora crassa cytochrome b5, several approaches can be used to assess and improve protein stability:

  • Differential scanning fluorimetry to determine thermal stability under various buffer conditions

  • Size exclusion chromatography to monitor aggregation over time

  • Activity assays to assess functional stability

  • Optimization of buffer components (pH, salt concentration, additives)

  • Addition of stabilizing agents such as glycerol (50% recommended for storage)

  • Avoidance of repeated freeze-thaw cycles, as specifically noted in the storage recommendations

A systematic approach testing these variables would help identify optimal conditions for maintaining the structural and functional integrity of the purified protein.

What controls should be included when designing functional assays for Neurospora crassa cytochrome b5?

When designing functional assays for Neurospora crassa cytochrome b5, several key controls should be included:

  • Apo-protein lacking heme as a negative control for heme-dependent activities

  • Site-directed mutants with alterations in the heme-binding site to confirm specificity

  • Heat-denatured protein to control for non-specific effects

  • Reactions lacking electron donors or acceptors to establish baseline activity

  • Cytochrome b5 proteins from other organisms for comparative analysis

  • Inhibitors of specific electron transfer pathways to confirm mechanism

These controls would help ensure the reliability and specificity of functional assays, particularly when investigating novel activities or interaction partners of Neurospora crassa cytochrome b5.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.