Recombinant Neurospora crassa Probable intron-encoded endonuclease 2 (NCU16009)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
NCU16009; Probable intron-encoded endonuclease 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
NCU16009
Target Protein Sequence
MNITLILFLIGILGFVLNRKNIILMLISIEIMLLAITFLILVSSLNMDDIIGQTYAIYII VVAGAESAIGLAILVAFYRLINSPVKNPRSNYSGDPAPPSGGRGPYLHFNLLPVVSSCNL IQSRNYSSVLHRKIPTHTSCVWAGLNPSFITGFSDAEGSFVVTILKNPRYKIGWNVQARF QIKLNEKDRALLLLIQNYFDNIGYISKINDRSTVEFRVSDITSLNNIIIPHFEKYQLITN KYGDLVIFKQIVSLMLENKHTTLEGLKEILEHRASLNWGLSKTLKESFPSIIPVKRVKIE NNILSNLSSLPLLPGGGNWVAGFSSGEANFFITMSGTKVWLRFSIAQDSRDILLLKSLVK FFNCGYIAQYKNRKVCEFIVTKINDIIIYIIPFFDQYKIEGSKYNDYVKFKEAAILIKNK EHLTEKGLNKIIELKNSLPPPASLEGGMNKNI
Uniprot No.

Target Background

Function
Mitochondrial DNA endonuclease involved in intron homing.
Database Links

KEGG: ncr:NCU16009

Protein Families
Complex I subunit 4L family; LAGLIDADG endonuclease family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the molecular identity of NCU16009?

NCU16009 is classified as a probable intron-encoded endonuclease in Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987). The full-length protein consists of 452 amino acids with UniProt accession number Q35134 . Based on comparative analysis with other fungal endonucleases, NCU16009 likely belongs to a family of nucleases involved in DNA cleavage activities. The protein may share structural and functional characteristics with other intron-encoded endonucleases that participate in mobile genetic element activity, such as homing or intron mobility. The available amino acid sequence data indicates NCU16009 contains specific motifs typical of endonucleases, though detailed structural characterization remains an area requiring further investigation.

How does NCU16009 compare to other characterized Neurospora crassa nucleases?

Neurospora crassa contains several nucleases with distinct cellular localizations and functions. The major nuclease activity in nuclei of N. crassa mycelia has been identified as an endo-exonuclease that acts endonucleolytically on single-stranded DNA and RNA while possessing highly processive exonuclease activity with double-stranded DNA . This nuclear endo-exonuclease shares immunochemical properties with extranuclear forms of the enzyme and shows 80-100% cross-reaction with antisera raised against purified extranuclear endoexonuclease . While direct comparative data between NCU16009 and the characterized nuclear endo-exonuclease is limited in the available literature, researchers should consider potential functional overlaps given that both proteins possess nuclease activity within the same organism. Comparative biochemical studies would be valuable to distinguish the substrate preferences, kinetic parameters, and biological roles of these different nucleases.

What are the predicted functional domains of NCU16009?

Based on sequence analysis and comparison with other intron-encoded endonucleases, NCU16009 likely contains specific domains for DNA binding and catalytic activity. Many intron-encoded endonucleases display modular architecture with distinct functional regions. For instance, homing endonucleases like I-Bth0305I contain a nuclease fold homologous to very short patch repair (Vsr) endonucleases, with conserved catalytic residues forming a composite sequence motif EDxHD . These residues typically include an essential aspartate that coordinates a catalytic magnesium ion, a histidine believed to act as a general base, and a neighboring aspartate residue . Additionally, NCU16009 may contain DNA-binding domains similar to nuclease associated modular DNA-binding motifs (NUMODs) found in other homing endonucleases . Detailed sequence and structural analysis would be necessary to confirm the presence of these domains in NCU16009.

What expression systems are optimal for recombinant NCU16009 production?

According to the available data, NCU16009 can be successfully expressed as a recombinant protein using in vitro E. coli expression systems . Researchers working with similar endonucleases have employed specific expression vectors such as pET-15HE or pGEX-6p-3 for protein production . Based on methodologies used for related proteins, an optimized expression protocol might include:

  • Cloning the NCU16009 gene into an appropriate expression vector with a fusion tag (e.g., GST or His-tag)

  • Transforming the construct into E. coli BL21(DE3)RIL cells using standard heat shock transformation

  • Growing cultures to mid-log phase (OD 0.5-1.1) before inducing with IPTG

  • Incubating cultures at reduced temperatures (16-25°C) to enhance proper protein folding

  • Purifying using affinity chromatography followed by tag removal with appropriate proteases

Studies with similar endonucleases indicate that fusion with glutathione-S-transferase (GST) may improve solubility and stability during expression and purification . Additionally, researchers should consider codon optimization for E. coli if expression yields are suboptimal.

What purification strategies ensure optimal enzyme activity for NCU16009?

Drawing from purification methods used for other endonucleases, a multi-step purification approach is recommended to obtain high-purity, active NCU16009. Based on protocols used for similar enzymes, researchers should consider:

  • Initial capture using affinity chromatography (GST or His-tag based)

  • Tag removal using specific proteases (e.g., PreScission protease for GST tags)

  • Secondary purification via heparin affinity chromatography, which has high affinity for DNA-binding proteins

  • Further polishing using size exclusion chromatography if needed

For instance, with the related endonuclease I-Bth0305I, researchers achieved >95% purity using a protocol where the protein was bound to glutathione resin, cleaved from its GST tag using PreScission protease, and further purified via heparin affinity chromatography with elution at approximately 1M NaCl . Activity assays should be performed after each purification step to ensure retention of enzymatic function.

How can researchers determine the DNA substrate specificity of NCU16009?

To characterize the DNA substrate specificity of NCU16009, researchers should employ multiple complementary approaches:

  • DNA footprinting assays: To identify protected regions when the enzyme binds to DNA

  • Systematic cleavage assays: Using a panel of DNA substrates with varying sequences to determine sequence preferences

  • Run-off sequencing: Performing sequencing on cleaved products to precisely map the cleavage sites

  • Mutational analysis: Creating targeted mutations in the DNA substrate to identify critical recognition nucleotides

Based on studies with I-Bth0305I, researchers should consider designing non-competitive cleavage digests using equimolar concentrations (e.g., 500 nM) of enzyme and linear DNA duplex substrates generated via PCR from plasmid templates . The resulting cleavage products can be analyzed using gel electrophoresis and sequenced to determine the precise cleavage sites. This approach revealed that I-Bth0305I recognizes a 14-bp pseudopalindromic sequence centered across its DNA cleavage site , providing a methodological framework for similar analyses with NCU16009.

What evidence suggests a role for NCU16009 in DNA repair pathways?

While direct evidence for NCU16009's involvement in DNA repair is limited in the available literature, insights can be drawn from studies of other nucleases in Neurospora crassa. The nuclear endo-exonuclease in N. crassa has been implicated in DNA repair based on several observations. Pretreatment of wild-type mycelia with the DNA-damaging agent 4-nitroquinoline-1-oxide (4-NQO) resulted in dose-dependent changes in endo-exonuclease levels, with low doses increasing active enzyme levels . Additionally, nuclei from the DNA repair-deficient uvs-3 mutant contained only 12% of the active enzyme and about 32% of inactive enzyme compared to wild-type nuclei . These findings were consistent with a role for endo-exonuclease in nuclear DNA repair.

To investigate whether NCU16009 plays a similar role, researchers could:

  • Examine NCU16009 expression and activity levels following exposure to DNA-damaging agents

  • Create NCU16009 knockout or knockdown strains and assess their sensitivity to DNA damage

  • Perform complementation studies in DNA repair-deficient mutants

  • Analyze genetic interactions between NCU16009 and known DNA repair genes

How might NCU16009 contribute to genome plasticity in Neurospora crassa?

As an intron-encoded endonuclease, NCU16009 may play a role in promoting genetic mobility and genome plasticity. Intron-encoded endonucleases often function as mobile genetic elements that can promote their own spread through populations by a process known as homing. This process involves the recognition and cleavage of specific DNA sequences, followed by repair processes that lead to the copying of the intron into previously intron-less alleles.

To investigate this potential role, researchers could:

  • Identify the precise target sequence for NCU16009 using methods described in section 2.3

  • Examine the distribution of the intron containing NCU16009 within different N. crassa strains

  • Develop in vivo assays to monitor potential homing events

  • Compare sequence conservation between NCU16009 and other known homing endonucleases

Understanding NCU16009's role in genome plasticity could provide insights into the evolutionary dynamics of mobile genetic elements in fungi and their contribution to genetic diversity.

What are the nuclear localization determinants for NCU16009?

To investigate NCU16009 localization:

  • Perform sequence analysis to identify potential nuclear localization signals (NLS)

  • Create fluorescently tagged versions of NCU16009 for live-cell imaging

  • Conduct subcellular fractionation followed by western blotting or enzymatic assays

  • Mutate potential NLS sequences to confirm their functionality

Understanding the localization determinants for NCU16009 would provide insights into its biological regulation and cellular function.

What mutagenesis strategies can elucidate the catalytic mechanism of NCU16009?

Structure-function studies through site-directed mutagenesis can provide valuable insights into the catalytic mechanism of NCU16009. Based on approaches used with other endonucleases, researchers should consider:

  • Catalytic residue mutagenesis: For similar endonucleases like I-Bth0305I, researchers created inactive variants by mutating the putative general base (H213A) or a metal-binding residue (D222A) . Similar conserved residues should be identified in NCU16009 through sequence alignment and mutated to alanine.

  • Domain deletion constructs: Creating constructs that express only the predicted catalytic domain, similar to how researchers generated a construct corresponding to amino acids 167-266 for I-Bth0305I .

  • Crystallization-facilitating mutations: For structural studies, introducing mutations that facilitate crystallization without affecting activity, such as the L180M mutation introduced in I-Bth0305I that could be expressed as a selenomethionyl residue for crystallographic phasing .

The impact of these mutations should be assessed through activity assays comparing wild-type and mutant proteins under identical conditions, providing insights into residues critical for DNA binding, catalysis, and structural integrity.

How can structural biology techniques advance understanding of NCU16009?

Advanced structural biology approaches would significantly enhance our understanding of NCU16009's molecular mechanism. Based on structural studies of related endonucleases, researchers should consider:

  • X-ray crystallography: To determine high-resolution structures of NCU16009 alone and in complex with its DNA substrate. This might require:

    • Optimization of protein constructs for crystallization

    • Introduction of selenomethionine for phase determination

    • Co-crystallization with DNA substrates of varying lengths

    • Use of catalytically inactive mutants to capture enzyme-substrate complexes

  • Cryo-electron microscopy (cryo-EM): For larger complexes or cases where crystallization proves challenging

  • Small-angle X-ray scattering (SAXS): To obtain low-resolution structural information about the protein in solution

  • NMR spectroscopy: For studying dynamics and interactions with smaller DNA fragments

Structural data would reveal the architectural organization of NCU16009, the nature of its interaction with DNA, and the precise arrangement of catalytic residues, illuminating the molecular basis for its substrate specificity and enzymatic activity.

What approaches can characterize NCU16009 activity in vivo?

Understanding NCU16009 function in its native cellular context presents significant technical challenges. Advanced approaches to address these challenges include:

  • CRISPR/Cas9-mediated genome editing: To create precise mutations or fluorescent protein fusions at the endogenous locus

  • ChIP-seq analysis: To identify genomic binding sites in vivo

  • RNA-seq following genetic manipulation: To understand transcriptional consequences of NCU16009 activity or absence

  • Development of in vivo activity reporters: Creating reporter systems that produce detectable signals upon NCU16009-mediated DNA cleavage

  • Mass spectrometry-based interactomics: To identify protein interaction partners that may regulate or be affected by NCU16009 activity

For these approaches, researchers could build upon established transformation techniques for N. crassa. Previous studies have developed transformation protocols yielding 10,000 to 50,000 stable transformants per microgram of DNA with recombinant plasmids, which would facilitate the genetic manipulation necessary for in vivo studies .

How does NCU16009 relate to endonucleases in other fungal species?

Comparative analysis of NCU16009 with homologous proteins in other fungi can provide evolutionary insights and functional predictions. Researchers should:

  • Perform comprehensive phylogenetic analysis using both sequence-based and structure-based approaches

  • Compare substrate specificities across related endonucleases from different fungal species

  • Examine the conservation of key catalytic residues and structural motifs

  • Investigate the correlation between endonuclease distribution and intron presence across species

This comparative approach would help position NCU16009 within the broader evolutionary context of fungal endonucleases and potentially reveal lineage-specific adaptations or conserved functional properties.

What can be learned from comparing intron-encoded versus free-standing endonucleases?

Intron-encoded endonucleases like NCU16009 have distinct evolutionary trajectories compared to free-standing endonucleases. To understand these differences, researchers should:

  • Compare structural features, particularly DNA-binding domains

  • Analyze target site preferences and cleavage mechanisms

  • Examine horizontal transfer potential and evolutionary rates

  • Investigate regulatory mechanisms controlling expression

Such comparisons would illuminate the evolutionary forces shaping different classes of endonucleases and provide insights into their respective roles in genome evolution and maintenance.

How might NCU16009 be utilized in biotechnological applications?

The site-specific DNA cleavage activity of endonucleases makes them valuable tools for biotechnological applications. Potential applications for NCU16009, once fully characterized, might include:

  • Genome editing tools if the specificity can be engineered or is naturally suitable

  • Molecular cloning applications for specific DNA manipulations

  • Development of novel recombination systems for genetic engineering

To explore these applications, researchers would need to thoroughly characterize the DNA binding specificity and cleavage properties of NCU16009, potentially using approaches similar to those that have been applied to other endonucleases such as I-Bth0305I .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.