Recombinant Neurospora crassa Probable intron-encoded endonuclease 4 (NCU16011)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

NCU16011 exhibits enzymatic activity typical of intron-encoded endonucleases:

  • Substrate Specificity: Acts on single-stranded DNA/RNA (endonuclease activity) and double-stranded DNA (processive exonuclease activity) .

  • Inhibitors: Sensitive to aurin tricarboxylic acid (20 μM), a known nuclease inhibitor .

  • Activation: Exists in both active and trypsin-activable forms, suggesting regulatory mechanisms for enzyme activity .

Role in DNA Repair

  • NCU16011 homologs in Neurospora crassa mitochondria and nuclei are implicated in DNA damage response. Exposure to 4-nitroquinoline-1-oxide (4-NQO), a DNA-damaging agent, triggers dose-dependent redistribution of endo-exonuclease activity, with active enzyme levels increasing at low doses .

  • The DNA repair-deficient uvs-3 mutant shows 88% reduced active enzyme levels in nuclei, correlating with hypersensitivity to 4-NQO .

Evolutionary Context

  • NCU16011 shares sequence homology with the LAGLI-DADG motif found in group I intron endonucleases, supporting a conserved mechanism for intron mobility across eukaryotes and archaea .

  • Mitochondrial genome analyses reveal NCU16011 as a conserved hypothetical protein without frameshift-inducing indels in wild-type strains, suggesting essential functional constraints .

Functional Insights

Functional AttributeDescription
DNA CleavageGenerates staggered double-strand breaks with 4-nt 3′ extensions, facilitating intron homing .
ThermostabilityNot directly tested for NCU16011, but related archaeal homologs (e.g., I-Dmo I) retain activity at high temperatures .
Cellular LocalizationDetected in nuclei, chromatin, and mitochondrial compartments .

Applications in Research

  • Genetic Engineering: Potential utility in targeted gene editing due to sequence-specific DNA cleavage.

  • DNA Repair Studies: Model enzyme for dissecting fungal DNA repair pathways, particularly in response to oxidative or alkylation damage .

  • Evolutionary Biology: Comparative studies of intron-encoded endonucleases across species .

Comparative Analysis with Homologs

FeatureNCU16011I-Dmo I (Archaeal Homolog)
SourceNeurospora crassaDesulfurococcus mobilis
ExpressionConstitutive (nuclear/mitochondrial)Induced from linear/cyclized introns
ThermostabilityNot characterizedRetains activity at 65°C
Catalytic MotifLAGLI-DADG-likeLAGLI-DADG

Key Challenges and Future Directions

  • Mechanistic Details: Structural studies (e.g., X-ray crystallography) are needed to resolve DNA-binding interfaces.

  • Functional Redundancy: Interactions with other DNA repair proteins (e.g., uvs-3 pathway components) remain uncharacterized .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
NCU16011; Probable intron-encoded endonuclease 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-545
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
NCU16011
Target Protein Sequence
MYLSIIILPLLGSIVAGFFGRKVGVSGAQLITCLSVIITTGLAILAFFEVGFNNIPVTIN LFRWIDSEWYNILWGFQFDSLTVAMLIPVLIISSLVHIYSISYMSHDPHNQRFFSYLSLF TFMMIILVTANNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSMSAFLTNRVGDCFLTI GMFVVLWTLGNLDYATVFSLAPYINSDIATIIGICLLIGAMAKSSQVGLHVWLPMAMEGF FSRAFLKLHYMQEHPVLSLGPLRFSLFGKIQDQGQFAGNSIRSSSEITSEAFMLKESWFK WWFIGFVEGDGSFIINKDGYLEFRITQSSPDAQILFMIKKELGFGVVRKQDSVRNTHCYR VRDKNNLIKLISIFNGNIFLDTRKEQFKLWLNAFNLKYKENIPHIDSSFRPNLDNAWLSG FTDAEGCFTCSVYDNKSNTAKLVRLRYILSQKGNSSCMEYLAEILGGKKHLLKSYEGYNV TVNTTKLSPIVQYFNLYPLKTKKYITYFNWIKIYKLVIDKKHNDPENLLLIMKYKNNINK SDYNK
Uniprot No.

Target Background

Function
Mitochondrial DNA endonuclease involved in intron homing.
Database Links

KEGG: ncr:NCU16011

Protein Families
Complex I subunit 5 family; LAGLIDADG endonuclease family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Neurospora crassa Intron-Encoded Endonuclease 4 (NCU16011)?

Neurospora crassa Probable Intron-Encoded Endonuclease 4 (NCU16011) is a protein encoded by a group I intron in the mitochondrial genome of the filamentous fungus Neurospora crassa. This protein belongs to a class of dual-function proteins that typically exhibit both endonuclease activity (DNA cleavage) and maturase activity (RNA splicing assistance). The full-length protein consists of 545 amino acid residues and has been successfully expressed in recombinant form with an N-terminal His-tag in E. coli expression systems . Group I intron-encoded proteins frequently function in intron mobility, allowing the genetic element to insert itself into homologous sites in intron-less alleles, a process known as homing.

How should recombinant NCU16011 protein be stored and handled?

For optimal stability and activity of recombinant NCU16011 protein, follow these methodological guidelines:

  • Storage conditions: Store the lyophilized protein at -20°C/-80°C upon receipt. For working aliquots, storage at 4°C is acceptable for up to one week .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

  • Buffer compatibility: The protein is provided in a Tris/PBS-based buffer with 6% Trehalose, pH 8.0 .

  • Stability considerations: Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. For experimental reproducibility, maintain consistent handling procedures across studies .

What are the structural characteristics of intron-encoded endonucleases like NCU16011?

Intron-encoded endonucleases like NCU16011 typically share several structural features that contribute to their dual functionality in RNA splicing and DNA cleavage:

  • Conserved domains: These proteins often contain LAGLIDADG motifs (P1 and P2 dodecapeptide sequences), which are hallmarks of this class of endonucleases . These domains are critical for DNA recognition and cleavage activities.

  • RNA-binding regions: Separate from the endonuclease domains, these proteins contain regions that facilitate binding to their cognate intron RNAs, enabling their maturase functions.

  • Tertiary structure: While specific structural data for NCU16011 is limited, related intron-encoded proteins form compact structures with distinct catalytic and binding domains that allow precise recognition of both RNA and DNA targets.

  • Functional elements: Analysis of similar proteins from Aspergillus nidulans has shown that these proteins typically recognize specific DNA sequences surrounding the intron insertion site and cleave at defined positions (often +1/-3 relative to the insertion site) .

Understanding these structural characteristics is essential for designing experiments to evaluate the protein's activity and for engineering applications that may utilize its site-specific cleavage properties.

What methodologies are optimal for assessing the dual endonuclease and maturase functions of NCU16011?

To comprehensively evaluate the dual functionality of NCU16011, researchers should implement the following methodological approaches:

For endonuclease activity assessment:

  • Site-specific DNA cleavage assay: Generate a DNA substrate spanning the putative homing site (construct a plasmid containing cDNA that spans the intron insertion site but lacks the intron itself) .

  • Mapping cleavage sites: Perform primer extension or sequencing reaction digestion to identify precise cut sites relative to the intron insertion position. Expect cleavage at positions +1/-3 relative to the intron insertion site, based on patterns observed in similar endonucleases .

  • Kinetic analysis: Measure cleavage rates under varying conditions (pH, temperature, divalent metal ions) to determine optimal enzymatic parameters.

For maturase activity assessment:

  • In vitro splicing assays: Incubate purified NCU16011 protein with its cognate pre-RNA containing the group I intron and monitor splicing efficiency over time using gel electrophoresis.

  • Comparative analysis: Compare splicing rates in the presence and absence of the protein to quantify stimulation .

  • RNA-protein binding studies: Employ electrophoretic mobility shift assays (EMSA) or filter-binding assays to characterize binding affinity and specificity.

For structure-function relationships:

  • Site-directed mutagenesis: Create point mutations in the conserved LAGLIDADG domains to separate endonuclease and maturase functions.

  • Domain swapping: Exchange domains with related proteins to identify regions critical for each function.

The integration of these approaches provides a comprehensive experimental framework for characterizing this bifunctional protein and understanding its role in intron mobility and RNA processing.

How does sequence variation in NCU16011 compare across different Neurospora crassa strains?

Analysis of mitochondrial genome variation across different Neurospora crassa strains reveals important insights about the conservation and variation of intron-encoded proteins like NCU16011:

Variation patterns in mitochondrial genomes:

Type of VariationFrequencyImpact on Intron-Encoded Proteins
Single Nucleotide Variants (SNVs)129 SNVs at 67 positions across strainsMostly in non-coding regions; only one synonymous substitution in NCU16015
Insertions/Deletions1,250 indels (553 unique changes)Some cause frameshift mutations in mitochondrial ORFs

While the search results don't provide specific variation data for NCU16011, the pattern observed in other mitochondrial intron-encoded proteins provides context. Unlike nuclear genes which show bias toward indels that preserve reading frames, mitochondrial ORFs frequently contain indels that disrupt reading frames, suggesting some may be pseudogenes resulting from ancestral duplications .

For NCU16011 specifically, researchers should compare sequence conservation across strains to identify:

  • Conserved catalytic domains critical for function

  • Variable regions that might influence substrate specificity

  • Potential strain-specific adaptations or loss of function

This comparative approach would help determine whether NCU16011 maintains consistent functionality across different Neurospora strains or has undergone strain-specific adaptations.

What experimental approaches can resolve contradictory data about maturase activity in intron-encoded proteins?

Resolving contradictory data regarding maturase activity in intron-encoded proteins like NCU16011 requires rigorous experimental approaches:

Source of contradiction: While genetic evidence suggests intron-encoded proteins function as maturases (mutating the ORF leads to accumulation of unspliced precursors), direct biochemical evidence of maturase activity has historically been difficult to obtain . This discrepancy has led to questions about whether these proteins directly or indirectly facilitate splicing.

Resolution approaches:

  • Direct biochemical assays: Purify the recombinant NCU16011 protein and test its ability to directly stimulate splicing of its cognate intron RNA in vitro under carefully controlled conditions. This approach provided the first clear evidence that an Aspergillus nidulans intron-encoded protein directly functions as a maturase .

  • In vivo complementation systems: Develop heterologous expression systems where the only source of potential maturase activity is the experimentally introduced NCU16011, eliminating the possibility of indirect effects.

  • Structure-guided mutagenesis: Based on structural predictions, introduce mutations that:

    • Disrupt endonuclease activity without affecting potential RNA-binding sites

    • Alter RNA-binding domains while preserving endonuclease function

    This approach can separate the two functions and demonstrate direct maturase activity.

  • RNA-protein interaction mapping: Use SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) or other RNA structure probing techniques to identify specific RNA structural changes induced by protein binding.

  • Single-molecule approaches: Apply fluorescence resonance energy transfer (FRET) or optical tweezers to observe individual protein-RNA interactions in real-time, directly visualizing the splicing-enhancement mechanism.

These experimental strategies can provide definitive evidence regarding the direct maturase function of NCU16011 and resolve contradictions in the current understanding of these dual-function proteins.

How can recombineering approaches be optimized for studying NCU16011 function?

Recombineering (recombination-mediated genetic engineering) provides powerful approaches for studying NCU16011 function through targeted genetic modifications:

Optimized recombineering methodology:

  • High-throughput conditional knockout system: Utilize recombineering in a 96-well format as described for mammalian genes to generate conditional knockouts of NCU16011 . This approach allows:

    • Precise control over gene expression

    • Temporal regulation of protein activity

    • Tissue-specific analysis in model organisms

  • Selection cassette design: Implement specialized selection cassettes such as loxP-F3-PGK-EM7-Neo-F3 or I-SceI-Bsd-I-CeuI for efficient selection of recombinants . These cassettes enable:

    • Clean removal of selection markers

    • Prevention of interference with gene function

    • Sequential genetic modifications

  • Site-specific mutagenesis: Engineer precise mutations in the conserved domains of NCU16011 to dissect structure-function relationships:

    • Target LAGLIDADG motifs critical for endonuclease activity

    • Modify RNA-binding domains involved in maturase function

    • Create chimeric proteins to investigate domain functions

  • Validation protocol:

    • Confirm successful modification by PCR and sequencing

    • Verify absence of unwanted background mutations

    • Test recombinant strains for both endonuclease and maturase activities

  • Experimental controls: Generate parallel constructs with known mutations that activate or inactivate specific functions (similar to the point mutation in S. cerevisiae cox1-I4α that activates latent maturase activity) .

Implementing these optimized recombineering approaches will facilitate detailed functional analysis of NCU16011, enabling researchers to dissect its dual roles in RNA splicing and DNA cleavage with unprecedented precision.

What is the evolutionary significance of the dual endonuclease/maturase function in NCU16011?

The dual functionality of proteins like NCU16011 provides key insights into evolutionary mechanisms of intron mobility and persistence:

Evolutionary implications:

  • Selfish genetic element propagation: The endonuclease activity promotes intron mobility by creating double-strand breaks at intron-less sites, facilitating intron homing . This "selfish" behavior increases intron frequency within populations.

  • Selection pressure balance: The maturase activity ensures proper splicing of the intron, reducing potential negative impacts on host fitness. This creates an evolutionary balance where:

    • Endonuclease activity promotes spread of the intron

    • Maturase activity minimizes fitness costs to the host

    • Both functions together increase the evolutionary persistence of the element

  • Horizontal gene transfer facilitation: The dual functionality promotes successful horizontal transfer of group I introns between species since:

    • Endonuclease activity enables insertion into new genetic backgrounds

    • Maturase activity ensures proper splicing in the new host environment

    • This mechanism explains the widespread but patchy distribution of similar introns across diverse fungi

  • Evolutionary transition model: These dual-function proteins may represent evolutionary intermediates:

    • Ancient ribozymes (self-splicing introns) acquired protein-coding capacity

    • Proteins evolved to enhance splicing (maturase function)

    • Later acquisition of endonuclease activity enabled mobility

    • In some lineages, these proteins were eventually co-opted for host functions

The preservation of both functions in proteins like NCU16011 suggests ongoing selective advantage for intron mobility in fungal mitochondrial genomes, making them excellent models for studying the evolution of selfish genetic elements.

How do variations in mitochondrial genome architecture impact NCU16011 expression and function?

Mitochondrial genome architecture variations significantly influence the expression and function of intron-encoded proteins like NCU16011:

Impact analysis:

  • Intron context effects: The sequence and structural context surrounding NCU16011 within its host intron affects:

    • Splicing efficiency of the host intron

    • Translation efficiency of the encoded protein

    • Coordination between splicing and translation processes

  • Strain-specific variations: Neurospora crassa strains exhibit substantial mitochondrial genome variation, including:

    • 129 single nucleotide variants (SNVs) at 67 positions

    • 1,250 insertions and deletions (553 unique changes)

    These variations can affect intron-encoded protein expression through:

    • Changes in RNA structural elements required for splicing

    • Alterations in regulatory sequences controlling translation

    • Modifications to RNA stability determinants

  • Pseudogene implications: Some mitochondrial ORFs in Neurospora crassa show indel patterns consistent with pseudogene status, resulting from ancestral duplications . To determine if NCU16011 is a functional gene or pseudogene, researchers should:

    • Compare sequence conservation across strains

    • Analyze selection pressure signatures (dN/dS ratios)

    • Verify protein expression in different genetic backgrounds

  • Experimental detection strategy:

    Analysis LevelTechniqueInformation Gained
    DNAWhole genome sequencingPresence/absence of NCU16011 across strains
    RNART-PCR, RNA-SeqTranscription and splicing efficiency
    ProteinWestern blot, Mass spectrometryTranslation and protein stability
    FunctionEndonuclease and splicing assaysActivity across genetic backgrounds

Understanding how mitochondrial genome architecture variations affect NCU16011 expression and function is essential for interpreting experimental results across different genetic backgrounds and for developing strain-specific experimental strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.