Recombinant Neurospora crassa Probable squalene synthase (erg-9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
erg-6; erg9; NCU06054; Probable squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
erg-6
Target Protein Sequence
MGAFTKAAYFLLHPNQLRSIVQWKVWHEPVHRRDPSKETETEKACFRHLELTSRSFSAVI QELNPELLMPICLFYLVLRGLDTIEDDMTIDLAKKEPLLREFADLMEIDGWTFTENGPNE KDRELLVHFDDVIAELKKVKKPYYDIIREITVKMGNGMADYALNAEHNTNGVNTIEEYEL YCHYVAGLVGEGLTRLFVESNLANPALLERMELTESMGQFLQKTNIIRDIHEDYVDKRRF WPKTIWSKYVNTWDDMFKPENREKALQCSSEMVLNALKHTEDCLFYMAGMRDQSVFNFVA IPQAMAIATLELVFRNPAIFERNVKITKGDACQLMMESTQNLRVVCEVFRRYARRIHKKN DPRDPNYLAISVQCGKIEQFIESIFPTQDPKKIALAQAQNSNQTAANTTDNGDTTFLVLS MIGVLFVMGGLMIGAAWLMGARFDMAYEDITARVGTLVNGAAAVSSATVSSIPTTVMHQE L
Uniprot No.

Target Background

Function
Recombinant *Neurospora crassa* Probable squalene synthase (erg-9) catalyzes the condensation of two farnesyl pyrophosphate molecules to form squalene. This enzyme initiates the committed step in sterol biosynthesis and is essential for ergosterol production.
Database Links

KEGG: ncr:NCU06054

Protein Families
Phytoene/squalene synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • How is the erg-9 gene structured in Neurospora crassa?

    The erg-9 gene in Neurospora crassa is also known as the erg-6 gene according to the Neurospora genome database . The gene encodes a microsomal enzyme that catalyzes the first committed step in sterol biosynthesis.

    Key structural features of the erg-9 gene include:

    • Presence of regulatory elements in the proximal promoter region that control gene expression

    • Based on similar studies in yeast, the promoter likely contains upstream repressing cis-elements (URS) and upstream activating cis-elements (UAS)

    • The encoded protein contains two hydrophilic active sites and an inhibitory pocket where the second half-reaction of squalene synthesis takes place

    The erg-9 gene in N. crassa has been characterized as part of the comprehensive genomic analysis of this model filamentous fungus, which has approximately 10,000 predicted protein-coding genes distributed across its genome .

  • What techniques are available for isolating and purifying recombinant Neurospora crassa squalene synthase?

    Isolation and purification of recombinant N. crassa squalene synthase typically involves:

    Expression Systems:

    • Heterologous expression in E. coli, yeast (S. cerevisiae), or insect cells using baculovirus

    • Homologous expression in N. crassa itself using suitable promoters

    Purification Protocol:

    1. Cell lysis: Mechanical disruption (French press or sonication) in appropriate buffer systems containing protease inhibitors

    2. Membrane fraction isolation: Differential centrifugation (microsomal enzyme isolation)

    3. Solubilization: Detergent-based extraction (typically with non-ionic detergents)

    4. Chromatography techniques:

      • Affinity chromatography (if tagged recombinant protein)

      • Ion exchange chromatography

      • Size exclusion chromatography

    Activity Verification:

    • Enzymatic assays measuring the conversion of radiolabeled FPP to squalene

    • Analysis of products by thin-layer chromatography or HPLC

    The enzyme requires either Mg²⁺ or Mn²⁺ for activity, and these should be included in assay buffers. Purification should be performed at low temperatures (4°C) to maintain enzyme stability .

Advanced Research Questions

  • What are the most effective genetic engineering approaches for manipulating erg-9 in Neurospora crassa?

    Several genetic engineering approaches have proven effective for manipulating erg-9 in N. crassa:

    CRISPR/Cas9 System:
    The recently developed CRISPR/Cas9 system for N. crassa offers significant advantages for erg-9 manipulation. A user-friendly system described by researchers achieves high editing efficiency:

    • Integration of cas9 into the fungal genome at the his-3 locus under ccg1 promoter control

    • Introduction of guide RNA via electroporation

    • Selection using cyclosporin resistance (csr-1) as a marker

    • 100% editing efficiency under selection conditions for targeted genes

    Homologous Recombination:

    • Traditional approach using flanking sequences for targeted integration

    • Can be combined with selectable markers for screening

    • Efficiency can be enhanced in strains with mutations in genes involved in non-homologous end joining

    RNAi-Based Approaches:

    • Quelling and meiotic silencing systems in N. crassa can be leveraged for knockdown

    • Introduction of hairpin RNA constructs targeting erg-9 mRNA

    ApproachEfficiencyAdvantagesLimitations
    CRISPR/Cas9100% (with selection)Precise, rapidRequires initial strain construction
    Homologous Recombination30-70%Well-establishedTime-consuming, labor-intensive
    RNAiVariableAllows partial knockdownIncomplete silencing

    For optimal results, combining CRISPR/Cas9 targeting with homology-directed repair has proven most effective for precision editing of erg-9 .

  • How do experimental designs for studying erg-9 function compare with Campbell and Stanley's experimental design framework?

    When applying Campbell and Stanley's experimental design framework to erg-9 function studies, several key considerations emerge:

    Pre-Experimental Designs vs. True Experimental Designs:
    Campbell and Stanley distinguish between pre-experimental designs (e.g., one-shot case studies) and true experimental designs with proper controls and randomization . For erg-9 studies:

    Design TypeApplication to erg-9 ResearchValidity Concerns
    One-Shot Case StudySingle knockout/overexpressionLow internal validity, confounded by history/maturation
    Pretest-Posttest Control GroupMeasurement before/after erg-9 manipulation with controlControls for most threats to internal validity
    Solomon Four-GroupTesting interaction effects of initial measurements with erg-9 manipulationHigh internal and external validity

    Threats to Validity in erg-9 Studies:

    1. Internal Validity Threats:

      • History: Background mutations affecting lipid metabolism

      • Maturation: Natural changes in gene expression during growth phases

      • Selection: Bias in isolating transformants

      • Testing effects: Repeated measurements affecting cellular response

    2. External Validity Concerns:

      • Reactive effects of experimental arrangements

      • Interaction of selection and experimental treatment

    Recommended Design for erg-9 Function Studies:
    The Pretest-Posttest Control Group Design (Design 4) with randomization provides the most robust framework for erg-9 research, measuring metabolite levels or phenotypic characteristics before and after genetic manipulation, while maintaining appropriate controls .

  • What regulatory mechanisms control erg-9 expression in Neurospora crassa, and how do they compare to other fungi?

    Regulatory mechanisms controlling erg-9 expression in N. crassa involve multiple layers of control:

    Transcriptional Regulation:

    • Promoter elements: Based on studies in yeast, the erg-9 promoter likely contains upstream repressing cis-elements (URS) and upstream activating cis-elements (UAS)

    • Transcription factors: Specific proteins bind to these regulatory elements to modulate expression

    • Evidence from other systems suggests that sterol regulatory element binding proteins (SREBPs) may be involved in regulation

    Post-Transcriptional Regulation:

    • mRNA stability: Studies in plant cells challenged with fungal elicitors showed approximately 5-fold decrease in SS mRNA levels

    • Studies in elicitor-challenged cells showed initial suppression of SS enzyme activity without corresponding changes in protein levels, suggesting post-translational control mechanisms

    Comparison with Saccharomyces cerevisiae:
    In S. cerevisiae, ERG9 regulation involves:

    • Non-ergosterol biosynthetic pathway genes like TPO1 and SLK19

    • TPO1 deletion leads to 5.5-fold increase in ERG9 expression

    • SLK19 deletion causes a 5.6-fold decrease in expression

    • These proteins interact with the regulatory cis-elements in the ERG9 promoter

    Metabolic Regulation:

    • Feedback inhibition: High concentrations of farnesyl pyrophosphate (FPP) inhibit the production of squalene but not of presqualene pyrophosphate (PSPP)

    • Enzyme requires Mg²⁺ or Mn²⁺ for activity

    • In the absence of NAD(P)H, PSPP accumulates rather than converting to squalene

    These regulatory mechanisms allow N. crassa to precisely control sterol biosynthesis in response to cellular needs and environmental conditions, representing an adaptation shared with other fungi but with species-specific nuances.

  • How does overexpression of erg-9 impact terpenoid production pathways in engineered Neurospora crassa strains?

    Overexpression of erg-9 (squalene synthase) in N. crassa creates significant impacts on terpenoid biosynthesis pathways:

    Redirection of Carbon Flux:

    • Increased erg-9 expression diverts carbon flow from the general isoprenoid pathway specifically toward sterol biosynthesis

    • This potentially reduces the availability of farnesyl diphosphate (FPP) for other terpenoid branches

    Effects on Terpenoid Production:
    Based on similar studies in other organisms:

    • Overexpression of squalene synthase may increase sterol production but potentially decrease production of other FPP-derived compounds

    • Engineering strategies often involve balancing the expression of multiple pathway enzymes

    Comparative Effects in Other Organisms:
    Studies in oleaginous yeasts have shown:

    • Downregulation of squalene synthase (ERG9) combined with overexpression of farnesyl diphosphate synthase (ERG20) increased production of sesquiterpenoids

    • Overexpression of ERG20 alongside tScHMGp expression resulted in 22.8 mg/L (+)-valencene and 978.2 μg/L (+)-nootkatone, compared to 10.9 mg/L and 551.1 μg/L respectively when only expressing tScHMGp

    • Increasing ERG20 copy number from two to three copies increased abscisic acid production with strain-dependency

    Engineered TargetEffect on Terpenoid ProductionDownstream Impact
    ERG9 overexpressionIncreased squalene and sterol productionDecreased availability of FPP for other terpenoids
    ERG9 downregulation + ERG20 overexpressionDecreased sterol production, increased sesquiterpenoid synthesisRedirects flux toward non-sterol terpenoids
    ERG20 overexpressionIncreased FPP poolEnhanced production of all FPP-derived compounds

    An optimal metabolic engineering strategy for specific terpenoid production in N. crassa would likely involve carefully balanced expression levels of multiple pathway enzymes, possibly including downregulation of erg-9 combined with overexpression of upstream enzymes .

  • What are the most sensitive analytical methods for quantifying squalene synthase activity in recombinant Neurospora crassa systems?

    Quantification of squalene synthase activity in recombinant N. crassa systems can be accomplished through several analytical methods with varying sensitivity and specificity:

    Radiochemical Assays:

    • Incubation with [14C]-labeled or [3H]-labeled FPP substrate

    • Extraction of lipid products and separation by thin-layer chromatography (TLC)

    • Quantification by scintillation counting

    • Sensitivity: Can detect picomole quantities of squalene

    • Advantages: High sensitivity, established protocol

    • Limitations: Requires radioactive materials, specialized disposal

    Chromatographic Methods:

    • HPLC with UV detection (λ = 210 nm)

    • GC-MS or LC-MS for higher sensitivity and specificity

    • Sensitivity: HPLC-UV (nanomole range), LC-MS/MS (femtomole range)

    • Advantages: No radioactivity, provides structural information

    • Limitations: More expensive equipment, complex method development

    Coupled Enzymatic Assays:

    • Measuring release of inorganic pyrophosphate

    • Coupled to secondary enzymatic reactions with spectrophotometric detection

    • Sensitivity: Micromole to nanomole range

    • Advantages: Real-time monitoring, no extraction required

    • Limitations: Possible interference from other pyrophosphate-releasing reactions

    Activity Conditions:
    Optimal activity conditions for N. crassa squalene synthase measurement include:

    • Buffer: Typically 50-100 mM Tris-HCl or phosphate buffer (pH 7.2-7.6)

    • Divalent cations: Required Mg²⁺ or Mn²⁺ (1-10 mM)

    • Reducing agent: DTT or β-mercaptoethanol (1-5 mM)

    • NADPH: 1-2 mM for the second half-reaction

    • Detergent: Low concentrations (0.1-0.5%) of non-ionic detergents

    • Temperature: 30-37°C (enzyme from mesophilic organism)

    For comprehensive activity profiling, combining radiochemical assays for high sensitivity with LC-MS/MS for product verification provides the most reliable results .

  • How can experimental designs for N. crassa erg-9 studies be optimized to minimize confounding variables?

    Optimizing experimental designs for N. crassa erg-9 studies requires careful consideration of potential confounding variables:

    Strain Background Considerations:

    • Use isogenic strains differing only in the erg-9 manipulation

    • Document the complete genotype of all strains used

    • Consider potential interactions with mating type and other genetic markers

    • N. crassa strain 74-OR23-1VA (FGSC#2489) carries dominant rec+ alleles that affect recombination frequencies and may influence genetic manipulations

    Growth Condition Standardization:

    • Strict control of temperature, light conditions, and media composition

    • Monitor and record growth phases for all experiments

    • Use internal controls to normalize for batch effects

    • Consider circadian effects on gene expression (N. crassa has well-characterized circadian rhythms)

    Randomization and Blocking:
    Implement Campbell and Stanley's experimental design recommendations :

    • Randomize the order of sample processing

    • Use blocking designs to control for known sources of variation

    • Include technical and biological replicates properly distributed across blocks

    Statistical Power Considerations:

    • Conduct power analyses to determine appropriate sample sizes

    • Report effect sizes alongside statistical significance

    • Use appropriate statistical tests that account for the distribution of your data

    Recommended Experimental Design Framework:

    Design ElementRecommendationRationale
    Control GroupsInclude wild-type, empty vector, and non-targeting CRISPR controlsControls for all aspects of the manipulation process
    ReplicationMinimum 3 biological replicates, 3 technical replicates eachAccounts for biological and technical variation
    NormalizationUse multiple reference genes or internal standardsImproves reliability of quantitative measurements
    Time CourseSample at multiple time pointsCaptures dynamic effects and controls for maturation effects
    Environmental VariablesSystematically vary one factor at a timeIdentifies interaction effects

    By implementing these design principles, researchers can significantly reduce confounding variables and strengthen causal inferences about erg-9 function .

  • What role does erg-9 play in the fungal stress response, and how can this be experimentally evaluated?

    Squalene synthase (erg-9) plays important roles in fungal stress response through several mechanisms:

    Stress Response Mechanisms:

    1. Membrane Integrity Maintenance:

      • Ergosterol (downstream of squalene) is crucial for membrane fluidity and integrity

      • Altered sterol composition affects membrane permeability and stress resistance

    2. Antioxidant Properties:

      • Squalene itself has antioxidant properties and acts as an oxygen-scavenging agent

      • May protect against oxidative stress and lipid peroxidation

    3. Regulatory Role:

      • Changes in sterol metabolism may trigger stress response pathways

      • Expression of erg-9 can be modulated in response to various stressors

    Experimental Evaluation Approaches:

    1. Stress Challenge Assays:

    • Subject wild-type and erg-9 mutant strains to various stressors:

      • Oxidative stress (H₂O₂, menadione)

      • Temperature stress (heat shock, cold shock)

      • Cell wall stress (Congo red, Calcofluor white)

      • Antifungal agents (particularly those targeting ergosterol)

    • Measure growth rate, survival, and morphological changes

    2. Molecular Response Analysis:

    • RNA-seq or qRT-PCR to measure expression changes of:

      • erg-9 itself under stress conditions

      • Other stress response genes in erg-9 mutants

    • Proteomics to identify changes in stress-response protein levels

    • Metabolomics to track changes in sterol and other metabolite profiles

    3. Cellular Imaging Techniques:

    • Fluorescent probes to assess membrane integrity and organization

    • ROS-sensitive dyes to measure oxidative stress levels

    • Live-cell imaging to track dynamic responses to stress

    4. Genetic Interaction Studies:

    • Create double mutants combining erg-9 modifications with mutations in known stress response genes

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    Experimental Design Considerations:

    • Include appropriate controls (wild-type and complemented strains)

    • Conduct time-course experiments to capture dynamic responses

    • Use multiple concentrations of stressors to establish dose-response relationships

    • Consider the impact of growth phase on stress resistance

    This multi-faceted approach would provide comprehensive insights into the role of erg-9 in fungal stress response and potential applications for antifungal development .

  • How can the CRISPR/Cas9 system be optimized specifically for erg-9 editing in Neurospora crassa?

    Optimizing CRISPR/Cas9 for erg-9 editing in N. crassa requires consideration of several key factors:

    Guide RNA Design Strategies:

    • Target unique regions of erg-9 with minimal off-target potential

    • Design multiple gRNAs targeting different exons of erg-9

    • Avoid regions with high GC content or secondary structures

    • Use N. crassa codon optimization for any expression cassettes

    System Components Optimization:
    Based on recent developments in CRISPR/Cas9 systems for N. crassa :

    1. Cas9 Expression:

      • Integration of cas9 into the genome at the his-3 locus

      • Expression under the control of the ccg1 promoter

      • Inclusion of nuclear localization signals for proper targeting

    2. gRNA Delivery:

      • Direct introduction of naked gRNA via electroporation

      • This approach eliminates the need for constructing multiple vectors

      • Co-targeting selectable markers (like csr-1) increases identification efficiency

    3. Selection Strategy:

      • Use cyclosporin resistance (csr-1) as a co-targeted selectable marker

      • 100% editing efficiency can be achieved under selection conditions

      • Combine gRNAs targeting both erg-9 and csr-1 to facilitate screening

    Experimental Protocol Refinements:

    StepOptimizationRationale
    Strain preparationUse NcCas9SG strain with integrated Cas9Ensures stable Cas9 expression
    Electroporation1.5 kV, 600 Ω, 25 μFOptimal parameters for N. crassa
    RecoveryVMM + SGF mediumSupports growth after transformation
    SelectionCyclosporin A (5 μg/ml)Selects for editing events
    ScreeningPCR and sequencing of erg-9 locusConfirms successful editing

    Validation and Efficiency Assessment:

    • Confirm editing by sequencing the erg-9 locus

    • Verify protein loss by Western blot or enzyme activity assays

    • Assess phenotypic changes in sterol profiles by GC-MS or LC-MS

    • Evaluate growth characteristics and stress responses

    This optimized CRISPR/Cas9 approach, based on recent advances in N. crassa genetic engineering, provides a rapid and efficient method for targeted manipulation of erg-9 with high specificity and minimal off-target effects .

  • What insights can comparative genomics provide about the evolutionary conservation of squalene synthase across fungal species?

    Comparative genomics reveals significant insights about evolutionary conservation of squalene synthase across fungal species:

    Sequence Conservation Patterns:

    • The core catalytic domains of squalene synthase are highly conserved across fungi

    • N. crassa squalene synthase (erg-9/erg-6) shares significant homology with other fungal squalene synthases

    • Comparison with the comprehensive genome sequence of N. crassa reveals its evolutionary relationships

    Phylogenetic Distribution:

    • Squalene synthase is present in all fungi as they require sterols for membrane function

    • The comprehensive analysis of over 1,100 predicted proteins from N. crassa genome sequence shows that many N. crassa genes lack homologs in yeasts like S. cerevisiae and S. pombe

    • This suggests that filamentous fungi like N. crassa may have distinct regulatory mechanisms for sterol biosynthesis enzymes including squalene synthase

    Functional Domain Analysis:

    • Active site residues are most highly conserved

    • Membrane-binding domains show more variability

    • Regulatory regions demonstrate species-specific adaptations

    Regulatory Element Comparison:

    • Promoter structures differ between species

    • Upstream regulatory elements show less conservation than coding sequences

    • Studies in S. cerevisiae identified specific regulatory elements (URS and UAS) in the ERG9 promoter that may have analogs in N. crassa

    Metabolic Context:

    • The sterol biosynthesis pathway is generally conserved across fungi

    • Species-specific adaptations exist in pathway regulation and end products

    • N. crassa synthesizes ergosterol as its main sterol, similar to other fungi but distinct from cholesterol-producing organisms

    Implications for Antifungal Development:

    • Conserved regions represent potential targets for broad-spectrum antifungals

    • Divergent regions may allow species-specific targeting

    • Understanding these evolutionary patterns can guide rational drug design

    Comparative genomic analysis of squalene synthase across fungal species provides valuable insights into fundamental aspects of sterol metabolism evolution and can inform both basic research and applied efforts in antifungal development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.