Recombinant Neurospora crassa Protein yop-1 (yop-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yop-1; 7F4.240; NCU06702; Protein yop-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
yop-1
Target Protein Sequence
MSSPQDRAQQYIGQLDKELSKYPTLNNLEKTTGVPKAYAVIGLVALYFFLIIFNLGGQLL TNLAGFVLPGYYSLNALFTASKQDDTQWLTYWVVFSLFTVIESLISVVYWFPFYFTFKFV FLLWLSLPTFKGAETIFRSFLAPTLGRYFQNGSTASGLRAKADAVHTD
Uniprot No.

Target Background

Function
Involved in membrane/vesicle trafficking.
Database Links

KEGG: ncr:NCU06702

Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YOP-1 and what is its role in Neurospora crassa?

YOP-1 (Protein yop-1) is a 168-amino acid protein in Neurospora crassa that functions as an ER tubule-forming protein. It plays a crucial role in organizing the endoplasmic reticulum structure, particularly in the peripheral ER at apical and near-apical regions of fungal hyphae. YOP-1 is notably present in regions devoid of nuclei, suggesting a specialized function in maintaining ER morphology distinct from regions rich in rough ER . The protein contributes to the dynamic nature of the smooth ER near the hyphal apex, indicating its importance in hyphal growth and organization. As an ER-shaping protein, YOP-1 helps establish and maintain the tubular network of the peripheral ER, which is essential for proper cellular function and hyphal extension in this filamentous fungus.

How should researchers store and reconstitute recombinant YOP-1 protein?

For optimal stability and activity of recombinant YOP-1 protein, follow these research-validated storage and reconstitution protocols:

Storage ConditionRecommendation
Long-term storage-20°C to -80°C in aliquots to avoid freeze-thaw cycles
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
Reconstitution methodBriefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Glycerol additionAdd 5-50% glycerol (final concentration) for long-term storage
Working aliquotsStore at 4°C for up to one week

It's critical to avoid repeated freeze-thaw cycles as these significantly reduce protein stability and activity . Before reconstitution, ensure the lyophilized powder is equilibrated to room temperature. After reconstitution, the addition of glycerol helps prevent protein aggregation and maintains structural integrity during freezing. For experimental work, thaw aliquots quickly at room temperature or in a 37°C water bath, then keep on ice while preparing experimental setups.

What expression systems are most effective for producing recombinant Neurospora crassa YOP-1?

E. coli is the most widely utilized and effective expression system for recombinant Neurospora crassa YOP-1 production. The BL21(DE3) strain or its derivatives like BL21(DE3)pLysS are particularly suitable due to their reduced protease activity, which enhances protein yield and stability . While other expression systems like yeast or insect cells might theoretically provide more eukaryotic post-translational modifications, the relatively simple structure of YOP-1 makes E. coli expression sufficient for most research applications.

For optimal expression in E. coli:

  • Clone the yop-1 gene (UniProt ID: Q871R7) into a vector containing a T7 promoter (e.g., pET19b or pET21a) with an N-terminal histidine tag for easier purification

  • Transform the construct into BL21(DE3) or BL21(DE3)pLysS E. coli cells

  • Induce expression using IPTG (typically 0.5-1.0 mM) when cultures reach mid-log phase

  • Allow expression to proceed for 3-4 hours at 30°C or overnight at 16°C to reduce inclusion body formation

  • Harvest cells by centrifugation and proceed with extraction under native or denaturing conditions depending on the protein's solubility

This approach typically yields 2-5 mg of purified recombinant YOP-1 per liter of bacterial culture .

What purification methods yield the highest purity and activity for recombinant YOP-1?

For high-purity, functionally active recombinant YOP-1, a multi-step purification strategy is recommended:

  • Initial extraction: Due to YOP-1's membrane association, extraction under denaturing conditions with 6M urea is often necessary to solubilize the protein from inclusion bodies .

  • Affinity chromatography: For His-tagged constructs, Ni²⁺ chelation chromatography is highly effective. Use a gradient elution with increasing imidazole concentration (20-500 mM) to minimize co-purification of contaminating proteins.

  • Step dialysis for refolding: Gradually remove denaturant through step dialysis:

    • Begin with 3M urea in phosphate-buffered saline (PBS)

    • Reduce to 1M urea in PBS

    • Finally dialyze against 0.5M urea in PBS

    • Complete with PBS alone

  • Size-exclusion chromatography: As a polishing step, apply the refolded protein to a size-exclusion column to remove aggregates and obtain >90% pure protein.

  • Quality control: Confirm purity using SDS-PAGE and Western blotting. Functional activity can be assessed through liposome binding assays or by analyzing the protein's ability to induce membrane curvature in artificial membrane systems.

This purification protocol typically yields protein with greater than 90% purity as determined by SDS-PAGE, suitable for structural and functional studies .

What is the subcellular localization pattern of YOP-1 in Neurospora crassa hyphae?

YOP-1 displays a distinctive localization pattern in Neurospora crassa hyphae, providing important insights into ER organization in filamentous fungi:

  • YOP-1-GFP localizes primarily to the peripheral ER (pER) at apical and near-apical regions that are devoid of nuclei (approximately 14.1 ± 2.2 μm from the apex) .

  • This localization pattern is notably different from ER chaperones like BiP-RFP, which are predominantly found in hyphal regions II and III (approximately 12 to 60 μm from the apex) where numerous nuclei are present .

  • YOP-1-GFP forms dynamic ER patches near the hyphal apex, resembling membranes stained with ER-Tracker Blue-White DPX in wild-type strains .

  • Three-dimensional reconstructions reveal that several peripheral ER membranes containing YOP-1 are interconnected, extending from the last cortical nuclei in hyphal region II toward the apex .

  • Some YOP-1-GFP-containing peripheral ER membranes surround the Spitzenkörper (SPK) core, suggesting a role in apical growth dynamics .

This distinct localization pattern indicates that YOP-1 plays a specialized role in organizing smooth ER (sER) structures at the hyphal apex, as confirmed by transmission electron microscopy, which is separate from the rough ER (rER) structures found in the subapical regions .

How does cellular stress affect YOP-1 localization and ER organization in Neurospora crassa?

Cellular stress dramatically alters YOP-1 localization and ER organization in Neurospora crassa, providing insights into stress response mechanisms:

  • ER stress inducers: When exposed to dithiothreitol (DTT, 10 mM) or tunicamycin (Tm, 50 μg/mL) for 1 hour, YOP-1-GFP no longer localizes to the apex. Instead, it completely co-localizes with BiP-RFP in clusters of peripheral ER membranes near nuclei . This suggests that ER stress triggers a reorganization of ER domains, potentially as part of the unfolded protein response.

  • Cytoskeletal disruption: Treatment with latrunculin A (LatA, 10 μM), which disrupts actin filaments, selectively affects YOP-1-GFP localization at the apical dome without altering BiP-RFP distribution . This indicates that the apical localization of YOP-1 is actin-dependent, unlike other ER proteins.

  • Stress-induced ER remodeling: The redistribution of YOP-1 during stress suggests a dynamic remodeling of ER domains, with smooth ER elements (marked by YOP-1) being particularly responsive to cellular stress conditions.

These findings highlight that YOP-1-associated ER domains are specifically targeted during stress responses, and the protein's localization is differentially regulated by ER stress inducers versus cytoskeletal disruptors. This suggests that YOP-1 may play a role in stress adaptation through reorganization of specific ER domains .

What techniques are most effective for visualizing YOP-1 localization in living fungal cells?

For optimal visualization of YOP-1 localization in living Neurospora crassa cells, the following techniques have proven most effective:

  • Fluorescent protein tagging: GFP fusion to YOP-1 (YOP-1-GFP) provides excellent visualization of the protein's dynamic localization patterns. C-terminal tagging appears preferable as it minimally impacts protein function .

  • Spinning disk confocal microscopy: This technique allows for 3D reconstructions and near real-time recordings of YOP-1-GFP dynamics, capturing the interconnected ER membrane network extending toward the hyphal apex .

  • Multi-channel imaging: Co-visualization of YOP-1-GFP with other markers such as BiP-RFP (for rough ER) enables analysis of distinct ER domains and their relationships .

  • ER-Tracker dyes: Complementary use of ER-Tracker Blue-White DPX provides validation of general ER structures that can be compared with YOP-1-specific localization .

  • Time-lapse imaging: For capturing dynamic reorganization of YOP-1-containing structures, especially in response to stress inducers or cytoskeletal disruptors.

  • Correlative light and electron microscopy (CLEM): For the highest resolution analysis, combining fluorescence imaging of YOP-1-GFP with transmission electron microscopy can definitively establish the relationship between YOP-1 localization and ultrastructural ER features .

When implementing these techniques, maintaining physiological conditions during imaging is critical, as temperature fluctuations or other stresses can rapidly alter YOP-1 localization patterns. Additionally, minimal laser exposure is recommended to prevent phototoxicity-induced stress responses that might affect YOP-1 distribution.

How does YOP-1 contribute to ER morphology and what are its binding partners?

YOP-1 plays a crucial role in shaping ER morphology in Neurospora crassa, particularly in generating and maintaining tubular ER structures. Current research indicates:

  • ER tubule formation: YOP-1 likely functions similarly to its homologs in other organisms by inducing membrane curvature through insertion of hydrophobic domains into the cytoplasmic leaflet of the ER membrane, promoting tubule formation rather than sheet structures .

  • Domain-specific activity: YOP-1's predominant localization at the peripheral ER of apical and near-apical regions suggests it specifically shapes smooth ER domains, distinct from the BiP-rich rough ER regions containing numerous ribosomes .

  • Potential binding partners: Though not explicitly identified in the available research, YOP-1 likely interacts with:

    • Cytoskeletal elements, particularly actin filaments, as suggested by the disruption of YOP-1 localization upon latrunculin A treatment

    • Other ER-shaping proteins such as reticulons and DP1/Yop1p family members

    • Proteins involved in ER-to-Golgi trafficking, given its localization near the Spitzenkörper

  • Functional domains: The transmembrane domains and membrane-inserted hairpin structures are likely critical for YOP-1's ability to shape ER tubules, though detailed structure-function analyses are still needed.

Future research using proximity labeling approaches (BioID or APEX2) coupled with mass spectrometry would be valuable for identifying the full complement of YOP-1 interacting partners in Neurospora crassa, providing deeper insight into its role in ER morphogenesis.

What is the relationship between YOP-1 function and hyphal growth in Neurospora crassa?

The spatial organization of YOP-1 suggests a significant relationship between its function and hyphal growth in Neurospora crassa:

  • Apical localization: YOP-1-GFP concentrates in the apical and near-apical regions of hyphae, precisely where the most active growth occurs, suggesting a role in supporting tip extension .

  • Spitzenkörper association: Some YOP-1-GFP-containing peripheral ER membranes surround the Spitzenkörper core, the vesicle supply center that directs polarized growth. This indicates YOP-1 may contribute to organizing ER domains that support vesicle trafficking required for cell wall deposition and plasma membrane expansion .

  • Actin-dependent positioning: YOP-1's apical localization depends on intact actin filaments, as demonstrated by latrunculin A experiments. This links YOP-1 function to the actin cytoskeleton, which is essential for polarized growth .

  • Smooth ER organization: YOP-1 appears to organize smooth ER elements at the hyphal apex, which have been confirmed by transmission electron microscopy. Smooth ER is associated with lipid synthesis and calcium regulation, both critical for sustaining hyphal extension .

  • Stress response integration: YOP-1 redistribution during stress conditions may contribute to growth modulation under adverse conditions, potentially as part of a mechanism to pause growth while cellular homeostasis is restored .

While direct functional studies (e.g., knockout or knockdown experiments) are needed to definitively establish the requirement of YOP-1 for hyphal growth, its strategic localization strongly suggests it facilitates the specialized ER organization needed for the rapid membrane and cell wall expansion characteristic of filamentous fungal growth.

How can researchers leverage YOP-1 as a tool for studying ER dynamics in filamentous fungi?

Researchers can effectively utilize YOP-1 as a powerful tool for investigating ER dynamics in filamentous fungi through several innovative approaches:

  • Domain-specific ER marker: YOP-1-GFP serves as a specific marker for smooth ER domains at the hyphal apex, complementing other markers like BiP-RFP that label rough ER regions. This combination enables comprehensive mapping of distinct ER domains and their dynamics during growth and stress responses .

  • Real-time visualization of ER remodeling: YOP-1-GFP enables observation of ER remodeling during:

    • Hyphal extension and branching

    • Responses to environmental stressors

    • Cell cycle progression

    • Developmental transitions

  • FRAP (Fluorescence Recovery After Photobleaching) analysis: By photobleaching YOP-1-GFP in specific regions, researchers can measure protein mobility and ER membrane dynamics, providing insights into the fluidity and connectivity of ER domains.

  • Structure-function analysis platform: Creating truncated or mutated versions of YOP-1 fused to fluorescent proteins allows determination of which domains are essential for:

    • Proper ER localization

    • Tubule formation

    • Stress-induced redistribution

    • Interaction with the cytoskeleton

  • Drug screening tool: The rapid redistribution of YOP-1-GFP in response to specific stressors makes it an excellent readout for screening compounds that affect ER organization or function in filamentous fungi.

  • Comparative studies across species: Using YOP-1 homologs tagged with fluorescent proteins across different fungal species can reveal conserved and divergent aspects of ER organization in filamentous fungi.

By implementing these approaches, researchers can gain unprecedented insights into the dynamic organization of the ER network in filamentous fungi and its adaptations during growth and stress responses.

What are common challenges when working with recombinant YOP-1 and how can they be addressed?

Researchers working with recombinant Neurospora crassa YOP-1 frequently encounter several challenges that can be addressed with appropriate methodological adjustments:

  • Protein solubility issues:

    • Challenge: YOP-1, as a membrane protein, often forms inclusion bodies during recombinant expression.

    • Solution: Express at lower temperatures (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) to slow protein production and improve folding. Alternatively, use denaturing conditions (6M urea) for extraction followed by controlled refolding through step dialysis .

  • Protein aggregation during storage:

    • Challenge: Purified YOP-1 may aggregate during freeze-thaw cycles.

    • Solution: Add 5-50% glycerol to storage buffer and store in small aliquots to minimize freeze-thaw cycles. For working stocks, maintain at 4°C for up to one week rather than repeatedly freezing and thawing .

  • Loss of functional activity:

    • Challenge: Purified protein may lose membrane-binding capability.

    • Solution: Verify protein activity immediately after purification using liposome binding assays. Consider native or mild detergent-based purification approaches rather than denaturing methods when functional studies are planned.

  • Inefficient antibody recognition:

    • Challenge: Antibodies raised against recombinant YOP-1 may not efficiently recognize the native protein.

    • Solution: Use multiple epitopes from different regions of YOP-1 for antibody production, particularly targeting predicted surface-exposed regions. Validate antibodies using both recombinant and native proteins.

  • Fluorescent tag interference:

    • Challenge: GFP tagging may affect YOP-1 localization or function.

    • Solution: Compare both N- and C-terminal tags, and validate with complementary approaches such as immunolocalization of the untagged protein. Small epitope tags (e.g., HA, FLAG) may have less impact on protein function than larger fluorescent proteins.

Addressing these challenges through careful experimental design and optimization will significantly improve research outcomes when working with this challenging but informative protein.

How can researchers differentiate between YOP-1's direct effects on ER morphology versus secondary consequences?

Distinguishing between direct effects of YOP-1 on ER morphology and secondary consequences requires sophisticated experimental approaches:

  • Acute protein inactivation: Utilize techniques such as:

    • Auxin-inducible degron (AID) system to rapidly deplete YOP-1

    • Optogenetic tools to transiently relocalize YOP-1 away from the ER

    • Temperature-sensitive alleles for conditional inactivation

    These approaches allow observation of immediate effects before compensatory mechanisms engage.

  • Structure-function analysis: Create point mutations or domain deletions that specifically disrupt:

    • Membrane binding without affecting protein stability

    • Protein-protein interactions while maintaining membrane association

    • Oligomerization without affecting membrane insertion

    This approach helps identify which molecular properties directly contribute to ER shaping.

  • In vitro reconstitution: Purify recombinant YOP-1 and test its ability to:

    • Induce tubulation of artificial liposomes

    • Alter membrane curvature in supported lipid bilayers

    • Function independently of other cellular factors

    Successful tubulation in purified systems would strongly support a direct role.

  • Quantitative imaging approaches:

    • Measure ER tubule diameter, branching frequency, and network connectivity

    • Use super-resolution microscopy (STED, STORM) to visualize nanoscale ER morphology

    • Apply computational image analysis to objectively quantify morphological changes

    These methods provide objective metrics for comparing wild-type and mutant conditions.

  • Temporal analysis:

    • Use high-speed time-lapse imaging to establish the sequence of events

    • Determine whether YOP-1 recruitment precedes or follows changes in ER morphology

    • Monitor dynamics during recovery experiments after drug washout

By combining these approaches, researchers can build a comprehensive understanding of which aspects of ER morphology are directly shaped by YOP-1 activity versus those that arise as secondary consequences of altered ER function or compensatory responses.

How does Neurospora crassa YOP-1 compare to homologous proteins in other fungal species?

Neurospora crassa YOP-1 belongs to a conserved family of ER-shaping proteins found across eukaryotes, with specific characteristics when compared to its homologs:

  • Evolutionary conservation: YOP-1 belongs to the DP1/Yop1p family, which includes:

    • Yop1p in Saccharomyces cerevisiae

    • REEP5/DP1 in mammals

    • Related proteins throughout fungi, plants, and animals

  • Structural features:

    • N. crassa YOP-1 contains the characteristic hydrophobic hairpin domains that insert into the ER membrane to induce curvature

    • At 168 amino acids , N. crassa YOP-1 is similar in size to S. cerevisiae Yop1p but smaller than mammalian homologs

  • Localization patterns:

    • Unlike S. cerevisiae Yop1p, which is distributed throughout the ER network, N. crassa YOP-1 shows distinct enrichment at the hyphal apex and subapical regions lacking nuclei

    • This specialized distribution pattern may reflect adaptation to the unique growth pattern of filamentous fungi

  • Functional specialization:

    • The apical localization of N. crassa YOP-1 suggests specialized functions in supporting hyphal tip growth that may not be present in non-filamentous fungi

    • Its association with smooth ER near the Spitzenkörper indicates adaptation to the filamentous growth form

  • Stress responses:

    • N. crassa YOP-1 undergoes dramatic redistribution during ER stress and cytoskeletal disruption

    • While stress-responsive relocalization occurs in other organisms, the specific pattern in N. crassa appears adapted to its polarized growth form

This comparative perspective highlights how a conserved protein family has been adapted to the specific cellular architecture and growth requirements of filamentous fungi, making N. crassa YOP-1 an excellent model for understanding both conserved and specialized aspects of ER organization across eukaryotes.

What insights does Neurospora crassa as a model organism provide for understanding ER dynamics in higher eukaryotes?

Neurospora crassa serves as an exceptional model organism for studying ER dynamics, offering several advantages that provide insights relevant to higher eukaryotes:

  • Evolutionary position: As a filamentous fungus, Neurospora occupies an intermediate evolutionary position between yeasts and higher eukaryotes, possessing features found in higher eukaryotes but absent in both budding and fission yeast . This makes it valuable for understanding conserved ER organization principles.

  • Cellular complexity: The coenocytic (multinucleate) syncytium of Neurospora provides a more complex cellular environment than yeasts, mimicking aspects of differentiated cells in multicellular organisms . This allows study of how ER domains form and are maintained in spatially complex cells.

  • Polarized growth model: The extreme polarized growth of fungal hyphae creates distinct cellular domains with specialized ER structures, similar to highly polarized cells in higher eukaryotes such as neurons. YOP-1's role in organizing apical ER may parallel specialized ER organization in polarized mammalian cells .

  • Visualizable ER domains: The clear spatial separation of smooth ER (marked by YOP-1) and rough ER (marked by BiP) in Neurospora hyphae provides an excellent system for studying the mechanisms that establish and maintain distinct ER domains . This segregation occurs in mammalian cells but is often more difficult to visualize.

  • Stress response relevance: ER stress responses in Neurospora show significant conservation with higher eukaryotes. The redistribution of YOP-1 during stress may reveal fundamental principles of stress-induced ER remodeling relevant to understanding human diseases involving ER stress.

  • Experimental advantages: Neurospora combines:

    • Sophisticated genetic tools

    • Rapid growth and easy culture

    • Excellent microscopic visualization

    • A fully sequenced genome

These features make it possible to investigate ER dynamics at a level of detail difficult to achieve in more complex organisms while maintaining relevance to higher eukaryotic systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.