Recombinant Neurospora crassa Putative dolichyldiphosphatase (17E5.220, NCU03718)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

The NCU03718 gene encodes a PAP2 domain-containing protein (UniProt: Q9C2M6) classified as a putative dolichyldiphosphatase (EC 3.6.1.43). Key features include:

  • Gene locus: 17E5.220 (Broad Institute annotation) .

  • Protein length: 282 amino acids (full-length recombinant form) .

  • Domains: Contains a PAP2 (phosphatidic acid phosphatase type 2) domain, which is evolutionarily conserved across fungi, plants, and animals .

Table 1: Orthologs of NCU03718

OrganismGene SymbolProtein Name
Saccharomyces cerevisiaeCAX4Dolichyl pyrophosphate phosphatase
Homo sapiensDOLPP1Dolichyldiphosphatase 1
Arabidopsis thalianaAT5G03080PAP2 domain-containing protein
Data derived from comparative genomic analyses .

Biochemical Properties

The recombinant protein is produced in optimized expression systems with the following specifications:

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

  • Purity: ≥90% by SDS-PAGE .

  • Sequence: Includes residues 1–282 of the native protein, with a predicted molecular weight of ~32 kDa .

Catalytic Activity:
Dolichyldiphosphatases hydrolyze dolichyl pyrophosphate (Dol-PP) to dolichyl phosphate (Dol-P), a rate-limiting step in the regeneration of Dol-P for glycosylation pathways . While direct activity assays for this recombinant form are not explicitly published, homologous enzymes (e.g., yeast CAX4) exhibit pH optima of 6.5–7.5 and require Mg²⁺/Mn²⁺ cofactors .

Functional Role in Glycosylation

Dolichol derivatives are essential for N-linked glycosylation and GPI-anchor biosynthesis. Key connections include:

  • Mannosyltransferase regulation: Dol-P serves as a carbohydrate carrier for mannose residues in glycoprotein synthesis .

  • Membrane dynamics: Structural variations in dolichols (e.g., saturation state) influence enzyme-substrate interactions, as shown for Trichoderma reesei dolichyl phosphate mannose synthase (DPMS) .

  • Cell wall integrity: Neurospora crassa mutants lacking GPI-anchored proteins (dependent on dolichol metabolism) exhibit defective hyphal growth and cell wall lysis .

Research Applications

  1. Glycosylation Studies: Used to investigate dolichol recycling in fungal protein glycosylation pathways .

  2. Enzyme Engineering: Serves as a template for optimizing thermostability or activity in biotechnological applications .

  3. Comparative Genomics: Evolutionary studies leverage its conservation across species to dissect metabolic adaptations .

Open Questions and Future Directions

  • Mechanistic details: The exact role of NCU03718 in Neurospora crassa’s dolichol cycle remains uncharacterized experimentally.

  • Interaction partners: Potential associations with GPI transamidase complexes or oligosaccharyltransferases warrant exploration .

  • Biotechnological potential: Engineering this enzyme could enhance glycosylation efficiency in fungal expression systems for therapeutic protein production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
17E5.220; NCU03718; Putative dolichyldiphosphatase; Dolichyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
17E5.220
Target Protein Sequence
MADNVTPLASLSLTHVYYNPDDPISLLCAWLALVPQALCVVYATLIWSTREAEVILMFAG QLACEAANFALKRLIKEERPARIHSTGGKGYGMPSSHAQFVSFWAVALGLFLLARHTPRE QQQQQQQKQKQRERKKQVTNVKTTTTNGSGNGSLFKTLTDSATDLERYAHEPWSFAHRFV ASLGALVLAGAVAWSRTYLGYHTEKQVLVGCGAGTLCAVAWFVVTHVVRQSGLLGQILDF PVVRWFRVRDLVVEEDLPQAGWEKWEEQRVARREVEERKKAL
Uniprot No.

Target Background

Database Links

KEGG: ncr:NCU03718

Protein Families
Dolichyldiphosphatase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is dolichyldiphosphatase and what is its function in Neurospora crassa?

Dolichyldiphosphatase (EC 3.6.1.43), also known as dolichyl pyrophosphate phosphatase, is an enzyme that catalyzes the hydrolysis of dolichyl pyrophosphate to dolichyl phosphate and inorganic phosphate. In Neurospora crassa, this enzyme is encoded by the gene NCU03718 (17E5.220) and plays a crucial role in the dolichol pathway, which is essential for N-linked glycosylation of proteins. The enzyme functions primarily in the endoplasmic reticulum membrane where it participates in the recycling of dolichol carriers during glycoprotein biosynthesis. The protein contains 282 amino acids and has several predicted transmembrane domains, consistent with its membrane-associated function . Understanding this enzyme's activity is particularly important since proper glycosylation is critical for protein folding, stability, and function in eukaryotic cells.

How should recombinant dolichyldiphosphatase be stored and handled for optimal stability?

For optimal stability and activity maintenance of recombinant Neurospora crassa dolichyldiphosphatase, proper storage and handling procedures are essential. The recombinant protein should be stored at -20°C in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein. For extended storage periods, conservation at -20°C or -80°C is recommended to maintain enzyme integrity. Importantly, repeated freezing and thawing cycles should be strictly avoided as this can lead to protein denaturation and loss of enzymatic activity .

For routine experimental work, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week, minimizing freeze-thaw cycles. When handling the protein, maintain sterile conditions and use appropriate enzyme buffers that match the optimal pH and ionic strength for dolichyldiphosphatase activity. Additionally, consider adding protease inhibitors to prevent degradation during experimental procedures, particularly for longer incubation periods.

What expression systems are suitable for producing recombinant Neurospora crassa dolichyldiphosphatase?

Several expression systems can be employed for the production of recombinant Neurospora crassa dolichyldiphosphatase, each with specific advantages depending on research goals. Since this is a eukaryotic membrane protein with potential post-translational modifications, selection of an appropriate expression system is critical for obtaining functional enzyme.

Expression SystemAdvantagesConsiderationsSuitable For
E. coliHigh yield, cost-effective, rapid growthMay lack proper folding for membrane proteins, limited post-translational modificationsInitial structural studies, antibody production
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, good for membrane proteins, moderate yieldGlycosylation patterns differ from filamentous fungiFunctional studies, larger-scale production
Insect cells (Baculovirus)More complex eukaryotic processing, good for membrane proteinsHigher cost, more technically demandingAdvanced functional studies, crystallography
Neurospora expression systemsNative processing environment, authentic modificationsLower yields, more specialized techniques requiredPhysiological studies, in vivo functional analysis

For most research applications, yeast expression systems offer a good balance between proper protein folding, post-translational modifications, and reasonable yields. When designing expression constructs, consideration should be given to codon optimization for the host organism and inclusion of appropriate purification tags that don't interfere with enzyme activity .

How can gene expression analysis be optimized for studying NCU03718 under different experimental conditions?

Optimizing gene expression analysis for NCU03718 under varying experimental conditions requires a multi-faceted approach combining several complementary techniques. RNA extraction is a critical first step and should be performed using established protocols for filamentous fungi. Total RNA extraction from Neurospora crassa tissue should begin by harvesting and grinding tissue in liquid nitrogen, followed by extraction using appropriate reagents that effectively handle the robust cell walls of filamentous fungi .

For quantitative analysis, northern blot assays using [α-32P]-UTP-labeled RNA probes provide reliable detection of NCU03718 transcripts. Design gene-specific primers that target unique regions of the NCU03718 sequence to ensure specificity. Signal normalization to rRNA levels is essential for accurate quantification across different samples .

For more comprehensive analysis, microarray or RNA-seq approaches can be employed. When preparing samples for such analyses, ensure high RNA quality is confirmed (e.g., using an Agilent Bioanalyzer) before proceeding. For microarray analysis specifically:

  • Treat RNA samples with DNase to remove genomic DNA contamination

  • Amplify RNA using appropriate kits (e.g., SenseAmp)

  • Prepare Cy-dye-labeled aminoallyl cDNA targets

  • Hybridize to arrays containing appropriate probes

For circadian or temporal expression studies, time-course experiments should be designed with appropriate light/dark transitions and sampling intervals. Cells grown in liquid culture should be transferred from constant light (LL) to constant darkness (DD) with samples harvested at regular intervals covering at least one full circadian cycle .

Statistical analysis should include student's t-tests or ANOVA to determine significant differences in expression, with p-values ≤ 0.05 considered statistically significant. For experiments investigating the effects of specific conditions (e.g., stress, nutrient availability) on NCU03718 expression, appropriate controls must be included to isolate the variable of interest.

What approaches can be used to characterize the enzymatic activity of recombinant dolichyldiphosphatase?

Characterizing the enzymatic activity of recombinant dolichyldiphosphatase requires specialized approaches that address both its membrane association and specific substrate requirements. A comprehensive characterization involves multiple complementary methods:

  • Substrate preparation: Dolichyl pyrophosphate substrate can be prepared synthetically or isolated from biological sources. For kinetic studies, radiolabeled substrates (often using 32P) allow for sensitive quantification of phosphate release.

  • In vitro activity assays: The basic enzymatic assay involves incubating purified recombinant enzyme with dolichyl pyrophosphate substrate and measuring the release of inorganic phosphate. Several detection methods can be employed:

    • Colorimetric phosphate detection (e.g., malachite green assay)

    • Radiolabeled substrate approaches tracking 32P release

    • Coupled enzyme assays where phosphate release is linked to a detectable reaction

  • Kinetic parameter determination: Establish Michaelis-Menten kinetics by varying substrate concentrations under optimal conditions. Calculate Km, Vmax, and kcat values to understand substrate affinity and catalytic efficiency.

  • Detergent considerations: As a membrane protein, the enzyme often requires detergents for solubilization and activity. Systematic testing of detergent types (non-ionic, zwitterionic) and concentrations is essential for optimizing activity.

ParameterOptimization RangeConsiderations
pH5.0-8.5Test in 0.5 pH unit increments
Temperature20-40°CConsider physiological relevance
Divalent cations0-10 mM Mg2+, Mn2+, Ca2+Test each individually and in combination
Detergents0.01-1% (w/v)Test multiple classes (DDM, CHAPS, OG)
Substrate concentration1-100 μMFor Km determination
  • Inhibitor studies: Testing known phosphatase inhibitors helps classify the enzyme and understand its mechanism. Key inhibitors to test include vanadate, fluoride, and specific dolichyldiphosphatase inhibitors if available.

  • Reconstitution studies: For more physiologically relevant activity assessment, reconstitute the purified enzyme into liposomes mimicking the ER membrane composition of Neurospora crassa.

For all activity assays, appropriate controls are essential, including heat-inactivated enzyme, no-enzyme controls, and when possible, comparison to native enzyme activity from Neurospora crassa microsomes.

How does dolichyldiphosphatase function integrate with circadian rhythms in Neurospora crassa?

Investigating the potential integration of dolichyldiphosphatase function with circadian rhythms in Neurospora crassa requires sophisticated experimental approaches that bridge glycosylation biochemistry with chronobiology. While dolichyldiphosphatase itself has not been directly established as a clock-controlled gene in available literature, many glycosylation-related processes show circadian regulation, suggesting potential temporal control of this pathway.

To examine potential circadian regulation of NCU03718, researchers should implement time-course studies under free-running conditions (constant darkness) following entrainment. Liquid cultures should be grown in constant light (LL) at 25°C for 24 hours and then transferred to constant darkness (DD) at 25°C, with samples harvested at regular intervals (typically every 4 hours) across at least 48 hours . RNA and protein extraction at each time point allows assessment of both transcriptional and translational rhythmicity.

For transcriptional analysis, northern blot assays using [α-32P]-UTP-labeled RNA probes specific to NCU03718 can be performed, with normalization to non-rhythmic controls. Alternatively, a luciferase reporter system can provide real-time monitoring of expression dynamics. A construct similar to the MAK-1::LUC fusion approach could be employed, where the dolichyldiphosphatase gene is replaced with a fusion to codon-optimized luciferase. This allows continuous monitoring of expression using a microplate luminometer, with readings taken every 90 minutes .

To determine if dolichyldiphosphatase activity is clock-regulated at the functional level, enzymatic assays should be performed with protein extracted at different circadian time points. Additionally, glycoprotein profiles should be analyzed across the circadian cycle to identify potential rhythms in glycosylation outcomes.

Integration with the core clock machinery can be assessed through several approaches:

  • Analyze NCU03718 expression in clock mutants (Δfrq, Δwc-1) compared to wild-type strains

  • Examine the NCU03718 promoter for circadian clock-regulated elements

  • Perform ChIP assays to determine if core clock proteins (WC-1, WC-2, FRQ) bind to the NCU03718 promoter

  • Create NCU03718 knockout or overexpression strains and assess impacts on core clock function

The intersection of glycosylation pathways with circadian rhythms represents an emerging area of research, as post-translational modifications can significantly influence protein stability, localization, and function in a temporally regulated manner.

What are the optimal conditions for purifying recombinant dolichyldiphosphatase?

Purification of recombinant dolichyldiphosphatase presents distinct challenges due to its membrane-associated nature. A systematic purification protocol should address solubilization, chromatographic separation, and activity preservation. The following methodological approach is recommended:

  • Expression and initial preparation: Express the recombinant protein with an appropriate affinity tag (His6, FLAG, or Strep-tag II) that doesn't interfere with the active site. After cell harvest, prepare membrane fractions through differential centrifugation, typically involving an initial low-speed centrifugation (3,000-5,000 × g) to remove cell debris followed by high-speed ultracentrifugation (100,000 × g) to pellet membranes.

  • Membrane solubilization: This critical step requires careful optimization of detergent type and concentration. Test a panel of detergents including:

    Detergent ClassExamplesWorking ConcentrationNotes
    Non-ionicDDM, Triton X-1000.5-2%Generally milder, often preserve activity
    ZwitterionicCHAPS, Fos-choline0.5-1.5%Intermediate harshness
    IonicSDS, sodium cholate0.1-0.5%More harsh, may denature

    Solubilization should proceed with gentle agitation at 4°C for 1-2 hours. The supernatant after ultracentrifugation (100,000 × g for 1 hour) contains solubilized protein.

  • Affinity chromatography: The choice of affinity purification depends on the tag incorporated:

    • For His-tagged protein: Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co2+ resins

    • For FLAG-tagged protein: Anti-FLAG antibody affinity resin

    • For Strep-tagged protein: Strep-Tactin resin

    All buffers should contain a concentration of detergent above its critical micelle concentration (CMC) but typically lower than that used for solubilization.

  • Secondary purification: If higher purity is required, consider:

    • Ion exchange chromatography based on the predicted isoelectric point of the protein

    • Size exclusion chromatography, which also helps confirm the protein's oligomeric state

  • Quality assessment: Verify protein purity using SDS-PAGE and western blotting with antibodies against the target protein or tag. Confirm identity with mass spectrometry if necessary.

  • Storage buffer optimization: The final buffer composition significantly impacts stability. For dolichyldiphosphatase, a Tris-based buffer (typically 20-50 mM, pH 7.5) containing 50% glycerol has been reported as effective . Additional components to consider include:

    • Salt (100-150 mM NaCl) to maintain solubility

    • Reducing agent (1-5 mM DTT or β-mercaptoethanol) if the protein contains reactive cysteines

    • Detergent at a concentration above CMC but sufficiently low to prevent interference with downstream applications

This purified protein can be stored at -20°C, but for extended storage, -80°C is recommended to maximize stability and activity retention .

How can DNA microarray approaches be utilized to study NCU03718 expression in different developmental contexts?

DNA microarray technology provides a powerful platform for studying NCU03718 expression across diverse developmental contexts in Neurospora crassa. Implementing this approach requires careful experimental design, precise technical execution, and rigorous data analysis.

Experimental Design Considerations:

When designing microarray experiments for developmental studies, several key factors must be addressed:

  • Developmental time points: Select stages that encompass the full developmental spectrum of Neurospora crassa, including:

    • Germination

    • Vegetative growth (different ages)

    • Asexual development (conidiation)

    • Sexual development (protoperithecia and perithecia formation)

    • Stress responses

  • Reference design: Implement a robust experimental design with appropriate biological replicates (minimum three) for statistical validity. Consider using a common reference sample against which all developmental stages are compared.

  • RNA extraction protocol: For developmental stages with different cellular compositions (particularly reproductive structures), optimize RNA extraction protocols for each tissue type to ensure comparable yield and quality. Confirm RNA quality using an Agilent Bioanalyzer before proceeding to amplification .

Technical Implementation:

  • Sample preparation:

    • Treat RNA samples with DNase (e.g., DNA-free from Ambion) to eliminate genomic DNA contamination

    • Amplify RNA using appropriate kits (e.g., SenseAmp)

    • Verify amplified RNA quality before proceeding

  • Array hybridization:

    • Prepare Cy-dye-labeled aminoallyl cDNA targets using an indirect labeling system

    • Design a dye-swap strategy to control for dye-specific biases

    • Use 70-mer oligonucleotide probes that include the NCU03718 sequence and relevant related genes

    • Include both technical and biological replicates

  • Microarray construction options:

    • Custom arrays can be designed using sequence information from public databases

    • Include probes for genes in related pathways (glycosylation, ER stress, dolichol metabolism)

    • Ensure probe specificity through in silico validation against the Neurospora genome

Data Analysis Framework:

  • Normalization: Apply appropriate normalization methods (e.g., LOWESS) to correct for dye biases and spatial effects.

  • Statistical analysis: Implement robust statistical testing (t-test for pairwise comparisons, ANOVA for multiple conditions) with appropriate multiple testing correction (e.g., Benjamini-Hochberg FDR).

  • Pattern identification: Apply clustering algorithms (hierarchical, k-means) to identify genes with expression patterns similar to NCU03718, potentially revealing co-regulated pathways.

  • Validation: Confirm key microarray findings through independent methods such as RT-qPCR or northern blot analysis using gene-specific probes .

  • Integration: Combine expression data with existing knowledge of glycosylation pathways to develop testable hypotheses about developmental regulation of dolichyldiphosphatase.

This comprehensive approach provides not only information about NCU03718 expression but also places it within the broader context of developmentally regulated gene networks in Neurospora crassa.

What strategies can resolve contradictory findings about dolichyldiphosphatase functions across different experimental systems?

When researchers encounter contradictory findings regarding dolichyldiphosphatase functions across different experimental systems, a systematic resolution strategy is essential for advancing understanding. These discrepancies may arise from genuine biological differences or methodological variations, and distinguishing between these possibilities requires carefully designed experiments and rigorous analysis.

Systematic Contradiction Resolution Framework:

  • Methodological Standardization:

    Begin by standardizing experimental protocols across systems to eliminate technical variability as a source of contradiction. Critical parameters to harmonize include:

    • Enzyme preparation methods (expression systems, purification protocols)

    • Reaction conditions (buffer composition, pH, temperature, detergent type/concentration)

    • Substrate preparation and quality assessment

    • Activity measurement techniques and quantification methods

    Conduct side-by-side comparative analyses using identical protocols where possible. This approach directly tests whether contradictions persist under standardized conditions.

  • Characterization of Enzyme Variants:

    Sequence variations between orthologs from different species or isoforms within species may explain functional differences. Consider:

    • Performing sequence alignments to identify critical differences in conserved domains

    • Creating chimeric enzymes by domain swapping to isolate regions responsible for functional differences

    • Site-directed mutagenesis of specific residues to test their contribution to functional divergence

    • Analyzing post-translational modifications that might differ between experimental systems

  • Context-Dependent Regulation:

    Investigate whether cellular context influences enzyme function through:

    • Reconstitution experiments with different lipid compositions mimicking various cellular membranes

    • Identification of interaction partners using co-immunoprecipitation or proximity labeling approaches

    • Analysis of subcellular localization across systems using fluorescent tagging and microscopy

    • Examination of tissue-specific or developmental regulation patterns

  • Multi-system Validation Strategy:

    Experimental SystemAdvantagesLimitationsKey Controls
    In vitro biochemicalPrecise control, mechanistic insightsLacks cellular contextEnzyme quality controls, substrate purity verification
    Heterologous expressionFunctional testing in vivoNon-native environmentEmpty vector controls, expression level normalization
    Neurospora genetic modelsNative context, physiological relevanceComplex system, indirect effectsMultiple knockout/knockin strains, rescue experiments
    In silico modelingStructure-function predictionsRequires validationMultiple algorithms, experimental verification

    Implementing experiments across these complementary systems provides a robust validation framework.

  • Advanced Analytical Approaches:

    • Structural biology: Determine high-resolution structures using X-ray crystallography or cryo-EM to identify conformational states that might reconcile functional differences

    • Single-molecule enzymology: Directly observe enzyme behavior at the molecular level to detect heterogeneity in activity

    • Systems biology: Integrate enzyme function within broader pathway models to understand compensatory mechanisms

    • Meta-analysis: Formally synthesize published results using statistical approaches to identify patterns in contradictory findings

How might dolichyldiphosphatase function be explored using genome-wide CRISPR screening approaches?

Genome-wide CRISPR screening represents a powerful approach for exploring dolichyldiphosphatase function in Neurospora crassa within a systems biology framework. This method can reveal genetic interactions, regulatory networks, and pathway connections that traditional approaches might miss. Implementing CRISPR screening for dolichyldiphosphatase functional exploration requires careful design considerations and methodological adaptations specific to filamentous fungi.

Screening Design Strategies:

  • CRISPR System Optimization for Neurospora:

    Successful CRISPR implementation in Neurospora requires adapting the system for filamentous fungi, which presents unique challenges:

    • Select appropriate promoters for Cas9 expression (e.g., ccg-1 or tef-1 promoters)

    • Optimize codon usage for Cas9 in Neurospora

    • Design effective gRNA delivery systems (plasmid-based or ribonucleoprotein complexes)

    • Establish efficient transformation protocols for library introduction

    Validation of the CRISPR system should be performed using known targets before proceeding to genome-wide applications.

  • Library Design Considerations:

    A comprehensive gRNA library should target:

    • All annotated genes in the Neurospora genome (~10,000 genes)

    • Multiple gRNAs per gene (4-6) to mitigate off-target effects and increase confidence

    • Inclusion of non-targeting controls for background estimation

    • Particular emphasis on genes in glycosylation, ER function, and membrane biology pathways

  • Phenotypic Screening Approaches:

    Several complementary screening strategies can reveal different aspects of dolichyldiphosphatase function:

    Screening ApproachReadoutAdvantagesTechnical Considerations
    Synthetic lethality with NCU03718 mutationGrowth/survivalIdentifies essential genetic interactionsRequires viable hypomorphic allele of NCU03718
    Glycosylation defect suppressors/enhancersGlycoprotein profilesLinks to specific pathway outputsRequires sensitive glycoprotein detection methods
    ER stress response modifiersUPR reporter activationConnects to cellular stress pathwaysReporter construct must be optimized for detection
    Dolichol pathway metabolite changesLipidomic profilesDirect biochemical connectionsRequires specialized mass spectrometry capabilities
  • Implementation Strategy:

    The screening workflow should include:

    • Generation of a base strain with reporter systems and/or mutations in NCU03718

    • Transformation with the gRNA library using optimized protocols for high coverage

    • Selection under appropriate conditions based on screening approach

    • Next-generation sequencing of gRNA abundance before and after selection

    • Computational analysis to identify genes with significant enrichment/depletion patterns

Data Analysis and Validation Framework:

  • Bioinformatic Analysis Pipeline:

    • Implement MAGeCK or similar algorithms to identify significantly enriched/depleted gRNAs

    • Apply stringent statistical thresholds with appropriate multiple testing correction

    • Cluster hits by pathway and cellular function

    • Perform network analysis to identify functional modules

  • Validation Hierarchy:

    • Primary validation: Individual knockout confirmation of top hits

    • Secondary validation: Detailed phenotypic characterization

    • Tertiary validation: Biochemical interaction studies

    • Mechanistic validation: Targeted experiments based on predicted functions

  • Systems Integration:

    The screening results should be integrated with:

    • Existing knowledge of glycosylation pathways

    • Transcriptomic data across conditions

    • Protein-protein interaction networks

    • Comparative analysis with orthologous systems in other fungi and higher eukaryotes

This comprehensive CRISPR screening approach promises to reveal new dimensions of dolichyldiphosphatase function within the complex cellular machinery of Neurospora crassa, potentially uncovering novel connections to cellular processes beyond the currently understood roles in glycosylation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.