Recombinant Neurospora crassa Rhomboid protein 2 (rbd-2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Pathways

rbd-2 is a key component of the Sterol Regulatory Element-Binding Protein (SREBP) pathway, which regulates sterol homeostasis and hypoxia adaptation in fungi. Key functions include:

  • SREBP Activation: Cleaves SREBP transcription factors (e.g., SAH-2 in N. crassa and SrbA in Aspergillus fumigatus), enabling their nuclear translocation to regulate ergosterol biosynthesis and hypoxia-responsive genes .

  • Cellulase Regulation: Mutations in rbd-2 result in cellulase hyperproduction by derepressing genes encoding lytic polysaccharide monooxygenases (LPMOs) and cellobiose dehydrogenases .

  • Virulence and Drug Susceptibility: In A. fumigatus, deletion of rbdB (the rbd-2 homolog) reduces extracellular siderophore production, increases azole susceptibility, and abolishes virulence in murine models .

Role in Hypoxia Adaptation

  • In N. crassa, Δrbd-2 strains fail to germinate under hypoxic conditions (0.2% O₂) .

  • In A. fumigatus, RbdB processes SrbA to activate genes required for hypoxia survival. Loss of RbdB eliminates detectable SrbA N-terminal fragments, impairing transcriptional regulation .

Industrial Applications

  • Enhanced Protein Secretion: Δrbd-2 mutants in N. crassa and Trichoderma reesei exhibit up to 56% higher β-glucosidase activity and increased extracellular protein concentrations, making them valuable for industrial enzyme production .

  • Bioreactor Optimization: Hypersecretion phenotypes in Δsah-2 (SREBP-deficient) strains are oxygen-dependent, suggesting scalable applications in controlled fermentation .

Table 1: Phenotypic Effects of rbd-2 Deletion

OrganismPhenotypeMechanismReference
N. crassaCellulase hyperproductionDerepression of LPMO/CDH-1 genes
A. fumigatusLoss of virulence, azole hypersensitivityImpaired SrbA cleavage
T. reeseiIncreased extracellular protein secretionDisrupted SREBP-mediated repression

Applications in Biotechnology

  • Enzyme Production: Used to engineer fungal strains for hyperproduction of cellulases and xylanases in biofuel industries .

  • Drug Target: Potential antifungal target due to its role in ergosterol biosynthesis and triazole resistance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us for prioritized development.
Synonyms
rbd-2; NCU02371; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
rbd-2
Target Protein Sequence
MAAQTLPASGAAVTFNTQRTRAYLLKLPLFTRATVLIIVLTWVLTLVGKSWNWDVKTWGA LIPDEIGIATLYRINTFPFIHLNIFHTILNIVAFTPLLERFEHEHGTLTSVALFFGPFAT IPGLIYVFVERFILHANTPVMGASMWVFLLLGMEAIRTYKTNPYFTISTYNIPTWITPLL LVVVTAALLPSSSFLGHLAGLLVGYGFGLGYLKFLAPPEWALRFIEGKLNLLGRLPHYVS VDQKTFGRFGVLPSSASSAEAGIPFSGVSGGQRLGP
Uniprot No.

Target Background

Function
Probable serine protease.
Database Links

KEGG: ncr:NCU02371

Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Neurospora crassa Rhomboid protein 2 (rbd-2) and what cellular pathway is it associated with?

Rhomboid protein 2 (rbd-2), encoded by gene NCU02371 in Neurospora crassa, is a homolog of the rhomboid protease Rbd-2/RbdB found in other fungi. It functions as a critical component of the Sterol Regulatory Element Binding Protein (SREBP) pathway. This pathway is evolutionarily conserved from yeast to mammals and plays a central role in sterol homeostasis regulation. In N. crassa specifically, rbd-2 participates in both ergosterol biosynthesis and the adaptation to hypoxic (low oxygen) conditions .

What transformation methods are most effective for introducing recombinant rbd-2 plasmids into Neurospora crassa?

When introducing recombinant rbd-2 plasmids into Neurospora crassa, researchers should be aware that transformation stability can be a significant challenge. Early studies with recombinant plasmids in N. crassa showed extreme meiotic instability, with less than 1-2% of progeny maintaining the transformed phenotype in backcrosses . For highest transformation efficiency, it's recommended to:

  • Use plasmid constructs with homologous flanking regions to facilitate targeted integration

  • Select an appropriate host strain containing a deletion that can be complemented by the recombinant gene

  • Verify stable integration through Southern hybridization to confirm chromosomal integration patterns

  • Be prepared for potential formation of high-molecular-weight plasmid multimers during transformation

How does rbd-2 function within the SREBP pathway to regulate hypoxic adaptation and what experimental approaches best elucidate this mechanism?

The rbd-2 protein functions as a rhomboid protease within the SREBP pathway that facilitates the processing and activation of SREBP transcription factors (particularly SAH-2 in N. crassa). To investigate this mechanism experimentally:

  • Generate targeted deletion strains (Δrbd-2) and complemented strains expressing tagged versions of rbd-2

  • Conduct growth assays under precisely controlled oxygen concentrations (0.2-21% O₂)

  • Perform comparative transcriptomics using RNA-Seq to identify differentially expressed genes between wild-type and Δrbd-2 strains under both normoxic and hypoxic conditions

  • Use chromatin immunoprecipitation followed by sequencing (ChIP-seq) to identify the direct targets of SREBP transcription factors that are affected by rbd-2 deletion

  • Measure ergosterol levels and intermediates using gas chromatography-mass spectrometry to determine specific alterations in the sterol biosynthesis pathway

This approach can reveal how rbd-2 proteolytic activity specifically regulates the adaptive response to hypoxia through the SREBP pathway.

What is the relationship between rbd-2 function and cellulolytic enzyme production in Neurospora crassa?

The relationship between rbd-2 and cellulolytic enzyme production represents an intriguing regulatory connection in N. crassa. Deletion of rbd-2 results in significant hyperproduction of cellulases compared to wild-type strains . To investigate this relationship:

  • Use quantitative protein secretion assays to measure total secreted protein levels in Δrbd-2 versus wild-type strains when grown on cellulose-containing media

  • Create double mutant strains (combining Δrbd-2 with constitutive expression of the cellulolytic regulator CLR-2) to assess how these pathways interact

  • Perform enzymatic activity assays for specific cellulases to determine if hyperproduction correlates with increased activity

  • Investigate whether the hyperproduction phenotype is directly linked to alterations in ergosterol content by simultaneously measuring intracellular ergosterol levels and cellulase production

Research indicates that the SREBP pathway components, including rbd-2, negatively regulate the expression of genes encoding cellobiose dehydrogenase (CDH-1) and lytic polysaccharide monooxygenases (LPMOs), suggesting a mechanistic link between sterol regulation and cellulolytic enzyme production .

What approaches can be used to study potential protein-protein interactions involving recombinant rbd-2 in Neurospora crassa?

To investigate protein-protein interactions involving recombinant rbd-2:

  • Generate epitope-tagged versions of rbd-2 (such as HA, FLAG, or GFP tags) that maintain native function

  • Perform co-immunoprecipitation (co-IP) experiments followed by mass spectrometry to identify proteins that physically interact with rbd-2

  • Use bimolecular fluorescence complementation (BiFC) to visualize potential interactions in living cells

  • Apply membrane yeast two-hybrid systems, which are more appropriate than conventional yeast two-hybrid for studying membrane-bound proteases like rbd-2

  • Perform reciprocal pull-down experiments with other components of the SREBP pathway (including SCP-1, SAH-2, and DSC-complex proteins) to validate direct interactions

When expressing recombinant rbd-2, researchers should consider the challenges of protein stability and proper localization, as transformation with recombinant plasmids in N. crassa can result in variable expression and potential formation of high-molecular-weight plasmid oligomers .

How can researchers effectively measure changes in ergosterol biosynthesis in Δrbd-2 mutants compared to wild-type Neurospora crassa?

To effectively measure changes in ergosterol biosynthesis in Δrbd-2 mutants:

  • Extract total sterols from mycelia using standardized protocols (e.g., with chloroform-methanol extraction)

  • Quantify total ergosterol content using UV spectrophotometry at 281.5 nm (characteristic absorption maximum)

  • Analyze sterol intermediates using gas chromatography-mass spectrometry (GC-MS) to identify specific accumulations or depletions in the biosynthetic pathway

  • Compare patterns of sterol intermediates between wild-type and mutant strains, paying particular attention to intermediates like 4,4-dimethyl-zymosterol and lanosterol which may accumulate in SREBP pathway mutants

  • Combine with transcriptomics to correlate changes in sterol profiles with altered gene expression of ergosterol biosynthesis enzymes

Research has shown that SREBP pathway mutants, including Δrbd-2, exhibit significantly lower ergosterol levels and altered patterns of sterol intermediates compared to wild-type strains, with specific accumulation of certain precursors indicating blocks at specific steps of the pathway .

What considerations are important when designing experiments to study recombinant rbd-2 localization in Neurospora crassa?

When designing experiments to study recombinant rbd-2 localization:

  • Choose an appropriate fluorescent tag (such as GFP or mCherry) that will not interfere with the membrane topology or catalytic activity of rbd-2

  • Place the tag at either the N- or C-terminus, considering the predicted membrane topology of rhomboid proteases, with careful validation that the tagged protein maintains normal function

  • Express the tagged protein under either native promoter (for physiological expression levels) or an inducible promoter (for controlled expression)

  • Use confocal microscopy with appropriate membrane markers (ER, Golgi, plasma membrane) to precisely determine subcellular localization

  • Consider that transformation of N. crassa with recombinant plasmids can result in meiotic instability, with transformants showing integration at multiple sites and potential formation of high-molecular-weight plasmid sequences

  • Validate localization data with subcellular fractionation and Western blotting to confirm microscopy findings

Additionally, researchers should verify that the recombinant rbd-2 construct complements the phenotypic defects (hypoxia sensitivity, altered cellulase production) observed in Δrbd-2 mutants to ensure that the tagged protein is functional.

What are the recommended approaches for studying the proteolytic activity of recombinant rbd-2 in vitro?

Studying the proteolytic activity of recombinant rbd-2 in vitro requires specialized approaches due to its nature as a membrane-embedded protease:

  • Express recombinant rbd-2 in a suitable heterologous system (E. coli, yeast, or insect cells) with purification tags (His, GST, or MBP)

  • Purify the protein using detergent solubilization (e.g., DDM, CHAPS) to maintain the native conformation of this membrane protein

  • Design fluorogenic peptide substrates based on the predicted cleavage sites in potential substrates (such as SREBP transcription factors)

  • Conduct in vitro proteolysis assays using purified rbd-2 and substrate proteins in reconstituted proteoliposomes or detergent micelles

  • Analyze cleavage products using SDS-PAGE, Western blotting, or mass spectrometry to identify specific cleavage sites

  • Include appropriate controls including catalytically inactive rbd-2 mutants (mutations in the catalytic serine or histidine residues)

When interpreting results, researchers should be aware that in vitro activity may differ from in vivo activity due to the absence of cofactors or appropriate membrane environment.

How can researchers effectively analyze the transcriptional changes regulated by the SREBP pathway in Δrbd-2 mutants?

To effectively analyze transcriptional changes regulated by the SREBP pathway in Δrbd-2 mutants:

  • Design RNA-Seq experiments comparing wild-type and Δrbd-2 strains under multiple conditions:

    • Normoxic (21% O₂) vs. hypoxic (0.2-1% O₂) conditions

    • Growth on different carbon sources (e.g., sucrose vs. cellulose-containing media)

    • Different time points during hypoxic adaptation

  • Perform differential expression analysis to identify genes up- or down-regulated in the Δrbd-2 mutant

  • Conduct pathway enrichment analysis to identify biological processes affected by rbd-2 deletion

  • Compare the transcriptional profile of Δrbd-2 with other SREBP pathway mutants (Δsah-2, Δscp-1, etc.) to identify shared and unique transcriptional effects

  • Validate key findings using quantitative RT-PCR and, where possible, protein-level measurements

Research has shown that deletion of SREBP pathway components, including rbd-2, affects the expression of genes involved in ergosterol biosynthesis, hypoxia adaptation, and unexpectedly, cellulolytic enzyme production. The transcriptional profile of Δrbd-2 mutants would be expected to show increased expression of cellulolytic enzyme genes, including those encoding cellobiose dehydrogenase (CDH-1) and lytic polysaccharide monooxygenases (LPMOs) .

What strategies can resolve meiotic instability issues when working with recombinant rbd-2 in Neurospora crassa?

Meiotic instability is a significant challenge when working with recombinant constructs in N. crassa. Studies have shown that transformants can exhibit extreme meiotic instability, with less than 1-2% of progeny maintaining the transformed phenotype in backcrosses . To address this issue:

  • Favor homologous integration strategies that target the recombinant construct to specific genomic loci, rather than relying on ectopic integration

  • Use transformation methods that promote single-copy integration rather than tandem repeats or high-molecular-weight multimers

  • Screen multiple transformants and select those with more stable integration patterns as determined by Southern blot analysis

  • Consider using strains with reduced homologous recombination capacity to potentially stabilize integrated constructs

  • When backcrossing is necessary, implement more stringent selection methods to recover the rare stable progeny

  • For functional studies, consider complementation tests with the native rbd-2 gene to verify that the phenotype observed is specifically due to the recombinant construct

Research with recombinant plasmids in N. crassa has shown that transformant DNA can be present predominantly in high-molecular-weight forms (larger than 20 kilobases), suggesting oligomerization of the plasmid sequences , which may contribute to instability.

How can researchers address potential functional redundancy between rbd-2 and other proteases in Neurospora crassa?

To address potential functional redundancy between rbd-2 and other proteases:

  • Conduct in silico analysis to identify all rhomboid proteases and related intramembrane proteases in the N. crassa genome

  • Generate single and combinatorial deletion mutants of rbd-2 and related proteases

  • Perform detailed phenotypic characterization of these mutants under various conditions (particularly hypoxia) to identify shared and unique functions

  • Use substrate specificity assays with purified recombinant proteases to determine if they can cleave the same targets

  • Perform rescue experiments by expressing other proteases under the rbd-2 promoter in the Δrbd-2 background to test functional complementation

  • Analyze the expression patterns of these proteases in different tissues and conditions to identify potential compensatory upregulation

Research has shown that while N. crassa has multiple components of the SREBP pathway, not all have redundant functions. For example, while deletion of rbd-2 causes hypoxia sensitivity, deletion of sre-2 (another SREBP pathway component) does not show this phenotype, suggesting specificity in function despite pathway similarities .

What potential applications exist for engineering recombinant rbd-2 variants with modified substrate specificity?

Engineering recombinant rbd-2 variants with modified substrate specificity could open several research avenues:

  • Structure-function studies to identify critical residues that determine substrate recognition by systematically mutating the catalytic domain and substrate-binding regions

  • Development of rbd-2 variants with broader or narrower substrate specificity for biotechnological applications

  • Creation of rhomboid proteases that can be regulated by external stimuli (chemical or light-inducible) to allow temporal control of SREBP pathway activation

  • Engineering rbd-2 variants that preferentially process specific substrates to dissect the multiple functions of the SREBP pathway

  • Design of inhibitor-resistant or inhibitor-sensitive variants for pharmacological studies

This approach would require detailed structural information about rbd-2 and its substrates, combined with protein engineering techniques and high-throughput screening methods to identify variants with desired properties.

How might the function of rbd-2 in the SREBP pathway be exploited to enhance cellulolytic enzyme production in Neurospora crassa?

The discovery that deletion of rbd-2 enhances cellulolytic enzyme production suggests potential applications for bioengineering:

  • Create precisely tuned rbd-2 mutants that maintain essential functions while enhancing cellulase production

  • Develop inducible systems to temporarily suppress rbd-2 activity during industrial enzyme production phases

  • Combine rbd-2 modification with overexpression of positive regulators of cellulase genes (such as CLR-2) to achieve synergistic effects

  • Investigate the molecular mechanism linking rbd-2/SREBP pathway to cellulase regulation to identify more targeted intervention points

  • Design feedback-controlled systems where rbd-2 activity automatically adjusts based on cellulase production levels

Research has demonstrated that deletion of SREBP pathway components, including rbd-2, results in hyperproduction of cellulases when exposed to cellulose . Understanding and manipulating this regulatory connection could lead to more efficient production systems for industrial enzymes while maintaining vital cellular functions.

What comparative genomics approaches could reveal the evolution of rbd-2 function across fungal species?

To investigate the evolution of rbd-2 function across fungal species:

  • Perform phylogenetic analysis of rhomboid proteases across diverse fungal lineages to trace the evolutionary history of rbd-2

  • Conduct synteny analysis to examine conservation of gene arrangement surrounding rbd-2 orthologs

  • Analyze selection pressure on different domains of rbd-2 using dN/dS ratios to identify regions under purifying or diversifying selection

  • Compare the functional consequences of rbd-2 deletion in multiple fungal species through targeted gene knockout studies

  • Use heterologous complementation experiments to test if rbd-2 orthologs from different species can rescue the phenotypes of the N. crassa Δrbd-2 mutant

  • Compare the substrate specificity of rbd-2 orthologs to determine if functional divergence has occurred

This evolutionary perspective could reveal how the dual roles of rbd-2 in hypoxia adaptation and regulation of enzyme secretion emerged during fungal evolution and identify species-specific adaptations in this regulatory system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.