Recombinant Neurospora crassa Signal peptidase complex catalytic subunit sec11 (sec11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neurospora crassa Signal Peptidase Complex Catalytic Subunit sec11 (sec11)

The recombinant Neurospora crassa signal peptidase complex catalytic subunit sec11 (sec11) is a protein derived from the fungus Neurospora crassa. This protein is part of the signal peptidase complex, which plays a crucial role in the maturation of secretory and membrane proteins by cleaving their N-terminal signal peptides. The sec11 subunit is essential for the catalytic activity of the signal peptidase complex in various organisms, including fungi like Neurospora crassa.

Function of Signal Peptidase Complex

Signal peptidases are enzymes responsible for removing signal peptides from precursor proteins, allowing them to mature and function properly. In fungi, the signal peptidase complex typically consists of multiple subunits, with sec11 being a key catalytic component. This complex is located in the endoplasmic reticulum (ER) and is vital for protein secretion and membrane integration.

SubunitFunctionLocation
sec11CatalyticER lumen
Spc1RegulatoryER membrane
Spc2RegulatoryER membrane
Spc3CatalyticER lumen

Characteristics of Recombinant sec11

The recombinant Neurospora crassa sec11 protein is produced through genetic engineering techniques, allowing for large-scale production and purification. This protein is typically stored in a Tris-based buffer with glycerol to maintain stability and is available in various quantities for research purposes .

Key Features:

  • Species: Neurospora crassa

  • Protein Name: Signal peptidase complex catalytic subunit sec11

  • EC Number: 3.4.21.89

  • Sequence: The amino acid sequence of sec11 includes regions crucial for its catalytic activity .

Potential Applications:

  • Protein Maturation Studies: Understanding how sec11 functions can provide insights into protein maturation processes.

  • Biotechnology: Recombinant sec11 could be used in biotechnological applications to improve protein secretion efficiency in fungal systems.

References:

- provides insights into the role of signal peptidase complexes in yeast.
- offers details on the recombinant sec11 protein from Neurospora crassa.

Future Directions:

  • Investigating the specific role of sec11 in Neurospora crassa protein secretion.

  • Exploring potential applications in biotechnology for improved protein production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
sec11; NCU04519; Signal peptidase complex catalytic subunit sec11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
sec11
Target Protein Sequence
MLSGLANPRQAAVQLMNFGLILSTAFMMWKGISVITDSPSPIVVVLSGSMEPAFQRGDLL FLWNRNVLAETSVGEIVVYNVKGKDIPIVHRIVRKFGKGPEAKLLTKGDNNVSDDTELYA SGQDYLVRNDIIGSVFAYIPFVGYVTILLSEHPWLKTVMLGLMGLVVVLQRE
Uniprot No.

Target Background

Function

The Neurospora crassa signal peptidase complex catalytic subunit Sec11 is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum (ER). This signal peptide cleavage occurs during protein translocation—either co-translationally or post-translationally—through the translocon pore into the ER.

Database Links

KEGG: ncr:NCU04519

Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the signal peptidase complex in Neurospora crassa and what role does SEC11 play?

The signal peptidase complex (SPase) in Neurospora crassa is responsible for cleaving N-terminal signal peptides from secretory precursor proteins and membrane proteins during their maturation. Based on studies in related fungi, SEC11 serves as the critical catalytic subunit of this complex. In fungi like F. odoratissimum, the SPase complex typically consists of multiple components (Sec11, Spc1, Spc2, and Spc3), with SEC11 being essential for the complex's enzymatic activity. Deletion of SEC11 homologs leads to complete loss of signal peptidase activity both in vivo and in vitro, demonstrating its indispensable role in protein processing .

The signal peptidase complex performs the crucial function of enabling proper protein localization by cleaving signal peptides from nascent proteins as they are translocated into the endoplasmic reticulum. This process is fundamental for the correct targeting of secretory and membrane proteins to their appropriate cellular locations, making SEC11 essential for normal cellular function and viability in eukaryotic systems.

What phenotypes result from SEC11 deletion or mutation in fungal systems?

Based on studies in yeast and related fungi, deletion or significant mutation of SEC11 typically results in complete loss of signal peptidase activity. Since SEC11 contains the catalytic site of the signal peptidase complex, its absence prevents proper processing of secretory and membrane proteins. This leads to the accumulation of unprocessed precursor proteins that cannot be properly localized or folded .

In Saccharomyces cerevisiae, SEC11 is essential for viability, as are other core components of the signal peptidase complex. Similarly, in other fungi, SEC11 deletion mutants exhibit severe growth defects or lethality. The severity of these phenotypes underscores the critical importance of signal peptide processing for fundamental cellular processes, including protein secretion, membrane protein integration, and cell wall biosynthesis.

What expression systems are recommended for recombinant Neurospora crassa SEC11?

While specific protocols for N. crassa SEC11 expression have not been extensively documented, insights can be gained from approaches used with related proteins. For human SEC11C, E. coli expression systems using an N-terminal 6xHis-SUMO tag have proven effective for detection and purification . This tag system facilitates both purification via the His-tag and enhanced solubility via the SUMO fusion.

For fungal SEC11 expression, researchers should consider:

  • Codon optimization for the selected expression host

  • Inclusion of solubility-enhancing tags (such as 6xHis-SUMO)

  • Careful selection of expression conditions to prevent inclusion body formation

  • Potential use of specialized membrane protein expression systems

Given SEC11's membrane association, expression systems capable of properly folding membrane proteins may yield better results than standard cytosolic expression platforms. Depending on the research objectives, it may be beneficial to express only the luminal catalytic domain rather than the full-length protein including the transmembrane segment.

How can interactions between SEC11 and other signal peptidase components be studied in Neurospora crassa?

Several complementary approaches can be employed to investigate SEC11 interactions with other components of the signal peptidase complex:

  • Affinity Purification coupled with Mass Spectrometry (AP-MS): This approach has been successfully used to study signal peptidase complexes in F. odoratissimum. By tagging SEC11 with GFP or another affinity tag, researchers can purify SEC11 along with its interacting partners and identify them using mass spectrometry . This method provides an unbiased view of the complex composition.

  • Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein-protein interactions in living cells by bringing together two fragments of a fluorescent protein when the proteins of interest interact. It can confirm direct interactions between SEC11 and other SPase components in the native cellular environment.

  • Co-immunoprecipitation: Using antibodies against SEC11 or epitope-tagged versions to pull down protein complexes, followed by Western blotting to detect specific interacting partners.

  • Genetic interaction studies: Creating double mutants with partial loss-of-function alleles of SEC11 and other SPase components can reveal functional relationships through synthetic phenotypes.

The combination of these approaches can provide comprehensive insights into the composition, stoichiometry, and assembly of the signal peptidase complex in N. crassa.

What methodological approaches can identify substrates of Neurospora crassa SEC11?

Identifying the substrates processed by SEC11 requires approaches that can detect changes in protein processing when SEC11 function is altered:

  • Comparative proteomics: Analysis of secreted proteins or membrane fractions in wild-type versus SEC11-depleted strains can reveal proteins that accumulate in unprocessed form when SEC11 activity is compromised. Mass spectrometry-based approaches can identify proteins with retained signal peptides.

  • Pulse-chase experiments: Metabolic labeling of newly synthesized proteins followed by immunoprecipitation of specific candidates can track processing defects in SEC11 mutants, revealing the kinetics of signal peptide cleavage.

  • Global protein N-terminal analysis: Mass spectrometry methods focused specifically on protein N-termini can identify signal peptide cleavage sites by comparing N-terminal peptides in wild-type and SEC11 mutant backgrounds.

  • Conditional expression systems: Since complete SEC11 deletion is likely lethal, temperature-sensitive or inducible systems that allow controlled depletion of SEC11 can help distinguish direct from indirect effects on protein processing.

These approaches can be combined to generate comprehensive catalogs of SEC11 substrates and characterize sequence determinants that influence processing efficiency.

How can the csr-1 locus be used for studying SEC11 function in Neurospora crassa?

The csr-1 locus provides a valuable genetic tool for creating marked N. crassa strains that can be used in SEC11 functional studies:

The csr-1 gene encodes cyclosporin A binding protein, and mutations in this gene confer resistance to cyclosporin A. Researchers have developed methods to modify the csr-1 locus via homologous recombination, introducing specific sequence changes that serve as genetic markers . For SEC11 research, this system could be adapted to:

  • Generate strains expressing tagged versions of SEC11 for localization and interaction studies

  • Create strains harboring SEC11 variants with specific mutations to probe structure-function relationships

  • Implement regulated expression systems for SEC11

  • Develop competition assays between wild-type and SEC11-modified strains to assess fitness effects

The approach involves creating a linear DNA construct with homology to the target locus but containing the desired modifications. In N. crassa, this can be accomplished using PCR-based methods to generate constructs for transformation . The resulting strains can be detected and quantified using PCR-based assays, facilitating competition experiments and functional studies.

How do the components of the signal peptidase complex interact in Neurospora crassa?

Based on studies in related fungi, the signal peptidase complex in N. crassa likely consists of multiple interacting subunits, with SEC11 serving as the catalytic core. In F. odoratissimum, affinity purification and mass spectrometry experiments have shown that the four signal peptidase subunits (FoSec11, FoSpc1, FoSpc2, and FoSpc3) function as a complex .

The interaction pattern observed suggests that these subunits form a stable complex at the ER membrane. SEC11 and SPC3 likely contain the catalytic residues essential for peptidase activity, while SPC1 and SPC2 may play regulatory or substrate recognition roles. In particular, SPC1 has been shown in other systems to regulate signal peptidase-mediated processing of membrane proteins by influencing substrate sorting and protecting transmembrane segments from inappropriate cleavage .

To characterize these interactions in N. crassa specifically, researchers could employ fluorescently tagged components and colocalization studies, combined with biochemical approaches to isolate intact complexes.

What is known about the evolutionary conservation of SEC11 across fungal species?

Comparative genomic analyses indicate that SEC11 is evolutionarily conserved across fungal species, from yeasts to filamentous fungi. Studies have shown that N. crassa and A. nidulans share homologs for most predicted genes, suggesting conservation of function across filamentous fungi .

The conservation of SEC11 makes N. crassa a valuable model system for studying fundamental aspects of signal peptide processing that may be applicable across the fungal kingdom and potentially to other eukaryotes.

What strategies can be used to create conditional SEC11 mutants in Neurospora crassa?

Given the likely essential nature of SEC11, conditional mutants are valuable tools for functional studies. Several approaches can be considered:

  • Temperature-sensitive alleles: Random or directed mutagenesis can generate SEC11 variants that function normally at permissive temperatures but lose activity at restrictive temperatures. These can be identified by screening for growth defects that manifest only at higher temperatures.

  • Regulated promoter systems: Placing SEC11 under the control of an inducible or repressible promoter allows controlled expression. The thiamine-repressible promoter system or the qa-2 promoter (regulated by quinic acid) could be employed in N. crassa.

  • Degron-based approaches: Fusing SEC11 to a degron tag that triggers protein degradation under specific conditions provides temporal control over protein levels.

  • Chemical-genetic approaches: Engineering SEC11 to be sensitive to a specific inhibitor not affecting the wild-type protein allows rapid and specific inactivation.

For all these approaches, it is crucial to validate that the conditional system allows normal growth under permissive conditions while effectively depleting SEC11 function under restrictive conditions.

How can recombination techniques be applied to study SEC11 in Neurospora crassa?

N. crassa offers several genetic tools for studying gene function through recombination:

  • Homologous recombination: While historically challenging in N. crassa due to the predominance of non-homologous end joining, targeted modifications can be achieved, particularly using the csr-1 locus as described above .

  • CRISPR-Cas9 systems: Adapted for filamentous fungi, these can facilitate precise genome editing to introduce specific mutations or tags into the SEC11 locus.

  • Repeat-Induced Point mutation (RIP): This unique feature of N. crassa can be leveraged to generate mutations in duplicated sequences, potentially creating hypomorphic alleles of SEC11.

  • Traditional crossing approaches: N. crassa's sexual cycle allows combination of mutations through crossing, enabling genetic interaction studies between SEC11 and other genes.

When designing recombination experiments, researchers should consider the unique genomic defense mechanisms present in N. crassa, which may affect the stability and inheritance of introduced sequences .

What purification strategies are effective for Neurospora crassa SEC11 protein?

Purifying SEC11 presents challenges due to its membrane association. Effective strategies might include:

  • Detergent solubilization: Carefully selected detergents can extract SEC11 from membranes while maintaining its native structure and activity. Mild non-ionic detergents like digitonin or DDM are often suitable for membrane proteins.

  • Affinity tags: Adding tags such as His6, FLAG, or Strep can facilitate purification through affinity chromatography. The N-terminal 6xHis-SUMO tag approach used for human SEC11C might be adaptable to N. crassa SEC11.

  • Size exclusion chromatography: This can separate the intact signal peptidase complex from other cellular components while maintaining protein-protein interactions.

  • Ion exchange chromatography: This can further purify SEC11 or the intact complex based on charge properties.

For functional studies, it may be valuable to purify the entire signal peptidase complex rather than SEC11 alone, since the catalytic activity may depend on interactions with other subunits.

What assays can measure SEC11 catalytic activity in vitro?

Several approaches can assess the catalytic activity of purified SEC11 or the signal peptidase complex:

  • Fluorogenic peptide substrates: Synthetic peptides representing signal sequences, with fluorophore-quencher pairs that produce fluorescence upon cleavage, allow continuous monitoring of proteolytic activity.

  • MALDI-TOF mass spectrometry: This can directly measure cleavage of synthetic peptide substrates by detecting the appearance of cleavage products with characteristic masses.

  • In vitro translation systems: Coupled transcription-translation systems producing model substrates with signal sequences can be used to assay processing by added SEC11/SPase.

  • Reconstituted membrane systems: Liposomes or nanodiscs incorporating SEC11 and other SPase components can provide a more native-like environment for assessing activity on membrane-associated substrates.

When designing such assays, it's important to include appropriate controls, such as known SPase inhibitors or catalytically inactive SEC11 mutants, to confirm the specificity of the observed activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.