Recombinant Neurospora crassa Uncharacterized mitochondrial protein urf-LM (urf-LM)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant urf-LM is produced via heterologous expression in E. coli and purified using affinity chromatography . Technical specifications include:

ParameterDetails
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; reconstitution in sterile water with 50% glycerol recommended .

Functional Insights

While urf-LM remains uncharacterized, contextual data from N. crassa mitochondrial studies provide clues:

  • Genetic Context: The urf-LM gene is part of a cluster of mitochondrial open reading frames (URFs) with homology to apoptosis-inducing factors (AIFs) and NADH dehydrogenase subunits .

  • Hypothetical Roles:

    • May contribute to oxidative phosphorylation or mitochondrial membrane dynamics .

    • Potential redox activity due to conserved residues in homologous proteins .

  • Transcriptional Regulation: Co-expressed with other mitochondrial genes under stress conditions, suggesting compensatory roles .

Research Applications

Recombinant urf-LM is primarily used for:

  • Antibody Production: As an immunogen for raising antibodies against mitochondrial proteins .

  • Protein-Protein Interaction Studies: To identify binding partners in mitochondrial complexes .

  • Structural Biology: Crystallization trials to resolve its 3D structure .

Limitations and Future Directions

  • Functional Data Gap: No direct evidence links urf-LM to specific biochemical pathways .

  • Comparative Genomics: Homologs in other fungi (e.g., Podospora anserina) suggest conserved but unannotated roles .

  • Proteomic Studies: Integration with mitochondrial interactome datasets could clarify its role .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
urf-LM; NCU16002; Uncharacterized mitochondrial protein urf-LM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
urf-LM
Target Protein Sequence
MIKKVNNFLVIILVFLAVILTELIMFMELNSLTLLKCFIFVDLLLVFIPFSLPRMGGKVS SIKNLIDAIKTRIFFFNSCLFFSKIWLYENKITIFWVYTIWNGLNSIFCGIFMEDNYMAD IYSISPKNGGGDPAEGNTPSGNPDSTISYDFLAEARDRINTHKSEISTPTEGDKAILFSK DIPTYGQKKIYFQESSGLLSRRGLAPLSVREICDTLLTDKGLPPLNTVGLKSHLNTVDQN IVLYKEQVVKFNNTLRGIDQGNEPFFPDSSKKLFLEYKEILPHMVEINEKMGTNLCKEIK AKDPSFHHPLLTNNDSTSKPKEK
Uniprot No.

Target Background

Database Links

KEGG: ncr:NCU16002

Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Intermediate Research Questions

  • How is the urf-LM gene organized in the mitochondrial genome?

The urf-LM gene is located in the mitochondrial genome of Neurospora crassa. Based on research with similar mitochondrial URFs in N. crassa:

  • The gene spans approximately 969 base pairs (encoding 323 amino acids)

  • It likely uses the mitochondrial genetic code, where TGA encodes tryptophan rather than serving as a stop codon

  • It may contain introns, as observed in other mitochondrial genes like URF1, which has an intron of 1118 base pairs that divides the coding sequence into two exons

  • Transcription likely produces multiple transcript species that undergo processing, including intron removal and leader sequence trimming

Comparative analysis with other URFs suggests this organization may be important for regulation of gene expression in response to cellular conditions .

  • What is known about the evolutionary conservation of urf-LM across fungal species?

Phylogenetic analysis reveals that urf-LM belongs to a class of genes with interesting evolutionary patterns:

  • It appears to be relatively specific to Pezizomycotina (filamentous ascomycetes) based on similar patterns of lineage specificity observed in N. crassa

  • Significant homology has been detected to intronic URFs of the respective gene from Podospora anserina, suggesting these reading frames constitute a novel type of group I intronic URFs

  • These mitochondrial URFs evolve rapidly, with accelerated base substitution rates making sequence similarity difficult to trace across evolutionary distance

  • The protein likely belongs to the N. crassa-orphan category, with limited homology to proteins in other organisms

This limited conservation pattern may indicate a specialized role in filamentous fungi metabolism or adaptation .

  • What approaches can be used to study potential interactions between urf-LM and other mitochondrial proteins?

Several methodologies can elucidate protein-protein interactions:

TechniqueApplicationAdvantagesLimitations
Affinity purification-MSIdentify interaction partnersComprehensive, quantitativeMay lose weak interactions
Yeast two-hybridScreen for direct interactionsHigh-throughputFalse positives, membrane proteins challenging
Proximity labeling (BioID)Map protein neighborhoodsCaptures transient interactionsRequires genetic modification
Co-immunoprecipitationValidate specific interactionsWorks with endogenous proteinsRequires specific antibodies
FRET/BiFCVisualize interactions in vivoSpatial informationTechnical complexity

These methods can map urf-LM's position within the mitochondrial interactome and provide functional insights .

  • How might heterologous expression systems be optimized for studying urf-LM function?

Heterologous expression in Neurospora crassa presents unique challenges. Research indicates several strategies to improve expression:

  • Generate heterologous expression positive (hep) mutations that facilitate expression of non-native sequences, as demonstrated with cas9 sequences fused to native genes

  • Use ultraviolet radiation to generate mutant transgenic strains that can be screened for improved heterologous expression

  • Employ codon optimization to match the codon usage preferences of N. crassa

  • Consider fusion with well-expressed native proteins to enhance stability

  • Utilize inducible promoters to control expression levels

  • Implement sib selection procedures that have shown success in cloning N. crassa nuclear genes

These approaches can overcome N. crassa's recalcitrance to expressing most non-native DNA sequences introduced into its genome .

  • What is the relationship between urf-LM and other uncharacterized reading frames in fungal mitochondria?

Several mitochondrial uncharacterized reading frames have been identified in Neurospora crassa and related fungi:

  • URF1 encodes a subunit of the respiratory chain NADH dehydrogenase complex (Complex I)

  • urf-a, located between tRNA genes, uses the mitochondrial genetic code and mutations in this gene correlate with "mutator" activity affecting mitochondrial genome stability

  • These URFs often contain introns and use non-standard genetic codes, suggesting complex evolutionary histories

  • Some URFs appear to be involved in mitochondrial genome maintenance, respiration, and stress responses

The urf-LM protein may share functional similarities with these other URFs, potentially playing a role in respiratory chain function or mitochondrial gene expression regulation .

Advanced Research Questions

  • What experimental design would be most effective for investigating urf-LM's role in mitochondrial function?

A comprehensive experimental approach should include:

  • Genetic manipulation:

    • CRISPR-Cas9 mediated gene editing to create point mutations or deletions

    • Creation of conditional expression systems using inducible promoters

    • Complementation studies with homologs from related species

  • Functional assays:

    • Mitochondrial respiration measurements using oxygen electrodes

    • Membrane potential assessment with fluorescent dyes

    • ROS production quantification under various stress conditions

    • ATP synthesis rate determination

  • Structural biology:

    • Cryo-EM analysis of purified protein alone and in complex with interaction partners

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Systems biology:

    • Transcriptomic analysis comparing wild-type and mutant strains

    • Metabolomic profiling to detect metabolic shifts

    • Proteomic analysis of mitochondrial fractions

This multifaceted approach can establish causal relationships between urf-LM and specific mitochondrial functions .

  • How can contradictory data in urf-LM research be reconciled and analyzed?

When analyzing contradictory results in urf-LM research, implement this systematic approach:

  • Methodological assessment:

    • Examine differences in experimental conditions, strains, and techniques

    • Apply likelihood-based tests to detect statistical significance of contradictory results

    • Consider whether differences in sample preparation might affect outcomes

  • Experimental design analysis:

    • Evaluate whether experimental designs are appropriate for the hypotheses being tested

    • Consider implementing Latin Square Design for complex experiments with multiple variables

    • Assess whether appropriate controls were included

  • Data integration:

    • Use meta-analysis techniques to combine results from multiple studies

    • Implement statistical methods specifically designed to detect differential expression patterns

    • Apply ontology-based semantic interoperability analysis to find hidden contradictions

  • Validation studies:

    • Design experiments specifically to test contradictory findings

    • Use multiple complementary techniques to assess the same parameter

    • Consider genetic background effects that might explain discrepancies

This systematic approach can help resolve contradictions and advance understanding of urf-LM function .

  • What are the challenges in determining the three-dimensional structure of urf-LM and how might they be overcome?

Structural determination of mitochondrial membrane proteins presents several challenges:

ChallengeExplanationPotential Solutions
HydrophobicityMembrane proteins are difficult to solubilizeUse specialized detergents or nanodiscs
Expression levelsLow expression yields insufficient materialOptimize expression systems or use fusion tags
Protein stabilityMitochondrial proteins may be unstable outside native environmentInclude stabilizing lipids or binding partners
Conformational heterogeneityMultiple conformational statesUse conformation-specific antibodies or locked mutants
Crystal formationMembrane proteins resist crystallizationConsider cryo-EM as alternative to crystallography

A multi-technique approach combining limited proteolysis, cross-linking mass spectrometry, and computational modeling may provide structural insights when experimental structures are challenging to obtain .

  • How might urf-LM contribute to fungal adaptation to environmental stresses?

Emerging evidence suggests mitochondrial uncharacterized reading frames may play important roles in stress responses:

  • The N. crassa UPF complex regulates catalase-3 (cat-3) gene expression, which is essential for scavenging H₂O₂-induced oxidative stress

  • Under oxidative stress conditions, regulatory proteins are degraded, activating stress response genes

  • Mitochondrial proteins like urf-LM may function similarly to Late Embryogenesis Abundant (LEA) proteins, which contribute to stress resistance

  • Rapidly evolving species-specific genes (orphans) like urf-LM often play roles in adaptation and competition

  • Localization of orphan genes at subtelomeric regions, as observed in N. crassa, may facilitate rapid adaptation

Investigating urf-LM's expression patterns and knockout phenotypes under various stress conditions could reveal its role in fungal adaptation to changing environments .

  • What computational approaches can predict urf-LM function based on its sequence and genomic context?

Advanced computational methods can provide functional insights despite limited experimental data:

  • Homology-based approaches:

    • Profile Hidden Markov Models to detect distant homologs

    • Threading algorithms to identify structural similarities despite low sequence identity

    • Analysis of coevolutionary patterns to infer functional relationships

  • Network-based prediction:

    • Guilt-by-association analysis using co-expression data

    • Phylogenetic profiling to identify genes with similar evolutionary patterns

    • Analysis of genomic context conservation across species

  • Structure-based prediction:

    • Ab initio protein structure prediction using AlphaFold or similar tools

    • Molecular dynamics simulations to predict functional motions

    • Ligand binding site prediction to suggest potential substrates

  • Machine learning approaches:

    • Feature extraction from sequence and predicted structure

    • Integration of multiple data types (sequence, structure, expression, localization)

    • Transfer learning from characterized proteins to predict urf-LM function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.