Recombinant Neurospora crassa Uncharacterized mitochondrial protein urf-N (urf-N)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Urf-N is expressed in Escherichia coli systems and purified via immobilized metal affinity chromatography (IMAC) using a His-tag .

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
Purity≥85%–90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid freeze-thaw cycles

Sequence Analysis

The Urf-N sequence includes:

  • Repetitive motifs: NLGVEASNLGVEASNLGVEAPK (residues 120–140) .

  • Hydrophobic regions: Predicted transmembrane helices (residues 200–220) .

Subcellular Localization

  • Confirmed mitochondrial localization via fractionation studies .

  • Absence in cytoplasmic or matrix fractions under standard conditions .

Functional Hypotheses

While Urf-N remains uncharacterized functionally, parallels to other mitochondrial proteins suggest potential roles in:

  • Mitochondrial ribosome assembly: Analogous to MRP3 in N. crassa, which associates with ribosomal subunits .

  • Respiratory chain regulation: Similar to AIF-like oxidoreductases, though Urf-N does not directly affect complex I activity .

  • DNA repair/recombination: Mitochondrial DNA hyper-recombination observed in N. crassa mutants hints at Urf-N’s possible involvement .

Research Limitations and Future Directions

  • Functional ambiguity: No knockout studies or interactome data available.

  • Evolutionary conservation: Homologs in other fungi (e.g., Saccharomyces cerevisiae) remain unidentified.

  • Key questions:

    1. Does Urf-N stabilize mitochondrial ribosomes or membranes?

    2. Is it involved in stress responses or apoptosis?

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
urf-N; NCU16017; Uncharacterized mitochondrial protein urf-N
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-632
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
urf-N
Target Protein Sequence
MGNKKKSVGGKINFLELLTFIQFLTHKLTLTPPKPHLFVTSNLQASIWNWPSKSRITEIS KAIWMNMIKKFKIFIFFALPTMLIVKGIYICYDQEIWTLVFFTQNLVKNFPFFGLRLFNM IWVESNLGVEASNLGVEASNLGVEAPKASSIFLDLHLWTLMYLFGSLARIFGELYYSDFE LPAGVGGESCEKKTPSPRGPLTLYKKGSDSGASGGSDSPPSAKGNSGASSGPNQDRLAPE TDSEDETTQTDQGPRSRGYRKTRTRSMVRRRWIRDKPDWVEGLWTRSSTEGVENLDATKA SQTKSAAENLDAIKASQTPKSAAENLDAAAIKASQTPKSAAENLDAAKGSKSKSKSAVKK AAKAAKKLAAENLDAIKASQTPKSAAENLDAAAIKASQTPKSAAENLDAAKGSQTKSAPK NLAPITGSQAPKVKAALAEFLGIETSQLQTTAVVRELATKLEDDLPGSLDFADQENGNKI ISMLKLREFLQENNRYRSTIYKSLGQFMDPESHKNLKEILDKLEESKNLLMTEGQKHKNT FDRNSQQNTAYNFKGDMKKYLELQNKVQHSQMKNFKLAESIIQKNIQREYKCKELKDFLH QEFPTSCRDFNDQEMKLKKYFLNAFNQAKTKN
Uniprot No.

Target Background

Database Links

KEGG: ncr:NCU16017

Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How does urf-N fit into the broader genomic context of Neurospora crassa?

N. crassa has emerged as a significant model organism with a completely sequenced genome comprising approximately 10,000 predicted proteins . Many N. crassa genes, potentially including urf-N, do not have homologues in model yeasts like Saccharomyces cerevisiae and Schizosaccharomyces pombe . This unique genomic landscape makes N. crassa valuable for understanding fungal-specific biological processes and potentially discovering novel protein functions.

Methodological approach: Researchers should utilize the N. crassa genomic databases and resources such as the Munich Information Center for Protein Sequences (MIPS) Neurospora crassa database (MNCDB) to analyze urf-N in its genomic context . This includes examining surrounding genes, potential regulatory elements, and conservation patterns across fungal species.

What cellular localization data exists for urf-N, and how can it be experimentally verified?

While urf-N is annotated as a mitochondrial protein , experimental validation of this localization is essential.

Methodological approach: Researchers should employ multiple complementary techniques:

  • Fluorescent protein tagging (GFP fusion) for microscopy visualization

  • Subcellular fractionation followed by Western blotting

  • Proximity labeling techniques like BioID or APEX

  • Immunogold electron microscopy for precise localization

  • Analysis of mitochondrial targeting sequences using prediction algorithms like MitoFates or TargetP

What expression systems are optimal for recombinant urf-N production?

Methodological approach: Researchers should consider:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, simple culture, low costLimited post-translational modificationsInitial structural studies, antibody production
N. crassaNative environment, proper foldingLower yields, more complexFunctional studies, physiological relevance
Pichia pastorisEukaryotic PTMs, high secretionLonger development timeLarge-scale production, glycosylated forms
Insect cellsComplex eukaryotic PTMsExpensive, technically demandingStudies requiring mammalian-like modifications

For N. crassa-based expression, researchers should consider the optimized promoter Pccg1nr in a protease deletion strain, which has been successful for heterologous protein expression .

What purification strategies are most effective for recombinant urf-N?

Methodological approach: For His-tagged urf-N , a multi-step purification protocol is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Intermediate purification: Ion exchange chromatography based on predicted isoelectric point

  • Polishing: Size exclusion chromatography to ensure homogeneity

  • Quality control: SDS-PAGE, Western blot, and mass spectrometry to confirm identity and purity

  • Functional validation: Activity assays based on predicted function or binding partners

For mitochondrial membrane proteins, consider additional detergent screening to maintain native conformation during purification.

What approaches can determine the function of an uncharacterized mitochondrial protein like urf-N?

Methodological approach: A comprehensive functional characterization requires multiple complementary strategies:

  • Bioinformatic prediction: Use tools like Gene Ontology annotation, protein domain analysis, and structural prediction

  • Genetic manipulation: Generate knockout, knockdown, or overexpression strains in N. crassa

  • Protein interaction studies: Employ yeast two-hybrid, co-immunoprecipitation, or proximity labeling

  • Metabolomic profiling: Compare metabolite levels between wildtype and urf-N mutant strains

  • Mitochondrial function assays: Measure oxygen consumption, membrane potential, and ATP production

  • Transcriptomic analysis: Perform RNA-seq to identify genes affected by urf-N manipulation

  • Evolutionary analysis: Study conservation patterns across species to infer functional importance

How can researchers create and characterize urf-N mutants in N. crassa?

N. crassa offers sophisticated genetic tools for functional studies, including targeted gene deletion and modification.

Methodological approach:

  • Design knockout constructs using homologous recombination or CRISPR-Cas9 approaches

  • Utilize N. crassa's efficient transformation protocols, such as electroporation of conidia

  • Screen transformants using selective markers and PCR verification

  • Validate knockout at protein level using antibodies against urf-N

  • Phenotypic characterization should include:

    • Growth rates under various conditions

    • Mitochondrial morphology and function

    • Metabolic profiling

    • Stress responses

    • Life cycle progression

N. crassa's unique repeat-induced point mutation (RIP) mechanism can also be leveraged for gene silencing studies .

What cutting-edge techniques can be applied to study protein-protein interactions of urf-N?

Methodological approach: To comprehensively map the interactome of urf-N:

  • Proximity-dependent biotin identification (BioID): Fuse urf-N to a biotin ligase to identify neighboring proteins

  • Cross-linking mass spectrometry (XL-MS): Use chemical cross-linkers to capture transient interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Map binding interfaces and conformational changes

  • Cryo-electron microscopy: Visualize urf-N in complex with binding partners

  • Förster resonance energy transfer (FRET): Measure real-time interactions in living cells

These techniques should be applied in the context of different cellular conditions to identify condition-specific interactions.

How can researchers address contradictory results when studying urf-N function?

Methodological approach:

  • Systematic validation using multiple techniques: Verify findings using independent methodologies

  • Control experiments: Implement appropriate positive and negative controls

  • Strain background effects: Test in different genetic backgrounds of N. crassa

  • Environmental variables: Systematically vary growth conditions (temperature, carbon source, stress)

  • Post-translational modifications: Investigate if contradictory results arise from different protein states

  • Temporal considerations: Examine effects across different stages of fungal development

  • Statistical rigor: Employ appropriate statistical tests with sufficient biological replicates

Type of ContradictionValidation ApproachKey Controls
LocalizationUse multiple tagging methodsMitochondrial markers
Protein interactionsReciprocal pull-downsNon-specific binding controls
Phenotypic effectsComplementation studiesWild-type rescue
Expression effectsMultiple reference genesTime-course analysis

How can urf-N be utilized in heterologous expression systems for biotechnological applications?

Given N. crassa's emerging potential as a host for heterologous protein production , understanding urf-N could have biotechnological implications.

Methodological approach:

  • Evaluate urf-N as a potential fusion partner: Determine if urf-N can enhance stability or secretion of heterologous proteins

  • Optimize expression conditions: Test different promoters beyond the standard Pccg1nr promoter used for heterologous expression in N. crassa

  • Minimize protease degradation: Consider using the fourfold protease deletion strain that has shown success in heterologous protein production

  • Scale-up considerations: Follow established bioreactor protocols that have successfully scaled production from 1L to 10L systems

  • Fusion protein design: Consider using the truncated glucoamylase (GLA-1) strategy that has proven effective for secretion of heterologous proteins in N. crassa

What bioinformatic tools are most useful for analyzing uncharacterized mitochondrial proteins like urf-N?

Methodological approach: A comprehensive bioinformatic pipeline should include:

  • Sequence analysis:

    • BLAST for homology detection

    • Multiple sequence alignment tools (MUSCLE, Clustal Omega)

    • Phylogenetic analysis to identify evolutionary relationships

  • Structure prediction:

    • AlphaFold2 for protein structure modeling

    • ConSurf for evolutionary conservation mapping

    • MolProbity for structure validation

  • Function prediction:

    • InterProScan for domain identification

    • CELLO for subcellular localization prediction

    • MetaGeneAnnotator for mitochondrial gene prediction

  • Expression analysis:

    • Codon usage analysis to assess expression efficiency, as N. crassa shows significant variation in codon bias

    • EST database searching to estimate relative transcript levels

    • GEO and SRA databases for existing expression data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.