Recombinant Neurospora crassa V-type proton ATPase 16 kDa proteolipid subunit 2 (vma-11)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant vma-11 is produced via bacterial expression systems, with the His-tag facilitating affinity chromatography purification. Key production details include:

ParameterSpecificationSource
Expression VectorCustom-designed plasmids for E. coli expression
PurityHigh-purity recombinant protein (>90%)
Storage BufferTris-based buffer with 50% glycerol (optimized for stability)
ApplicationsBiochemical assays, structural studies, immunological detection (e.g., ELISA)

Functional Role in V-ATPase

As part of the V0 domain (membrane-embedded sector) of the V-ATPase, vma-11 contributes to proton translocation. Key findings include:

  • Proton Transport: The subunit’s conserved glutamic acid residues (e.g., Glu145 in yeast homologs) are critical for proton translocation . Mutations in analogous residues disrupt enzyme activity.

  • Essentiality: V-ATPase activity is indispensable in N. crassa, as demonstrated by lethal phenotypes in vma-1 knockout strains . While vma-11-specific knockouts are not explicitly documented, its homology to yeast VMA11 (essential for V-ATPase assembly) suggests a critical role .

  • Localization: In N. crassa, vacuolar ATPase subunits (e.g., vma-1, vma-5) localize to vacuolar membranes and tubules near hyphal tips, consistent with vma-11’s expected distribution .

Research Applications and Tools

vma-11 is utilized in structural and functional studies of V-ATPase:

ApplicationMethodologySource
ELISA DetectionQuantitative measurement of vma-11 levels in N. crassa lysates
Protein-Protein InteractionCo-immunoprecipitation (Co-IP) to study V-ATPase subunit assembly
Functional AssaysProton transport measurements in reconstituted liposomes

Evolutionary Conservation

vma-11 exhibits homology across eukaryotes, highlighting its conserved role in V-ATPase function:

OrganismGene/Protein IdentifierHomology (AA Identity)Source
Saccharomyces cerevisiaeVMA11 (NP_015090.1)~45%
Schizosaccharomyces pombevma11 (NP_593600.1)~40%
Arabidopsis thalianaVHA-C3 (NP_195603.1)~35%

This conservation underscores the subunit’s universal importance in proton translocation .

Challenges and Future Directions

  • Structural Elucidation: High-resolution crystallography or cryo-EM data for N. crassa vma-11 remains limited, unlike yeast homologs .

  • Functional Redundancy: Potential overlap with other proteolipid subunits (e.g., vma-3 in N. crassa) requires further investigation .

Key References

  1. Recombinant Production:

  2. Genomic Context:

  3. Functional Studies:

  4. Evolutionary Homologs:

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
vma-11; NCU00667; V-type proton ATPase 16 kDa proteolipid subunit 2; V-ATPase 16 kDa proteolipid subunit 2; Proteolipid protein vma-11; Vacuolar proton pump 16 kDa proteolipid subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
vma-11
Target Protein Sequence
MAEIMADSELAPKFAPFIGMAGIAAAMIFGSAGAAYGTAKSGIGIAGVGTFRPDLIMKCL IPVVMSGIIAVYALVVAVLIAQDLGPPGSGQHYSLFNGFMHLACGLSVGLTGLAAGYCIG IVGDKGVRSFMLQSRIFVGMVLILIFGEVLGLYGLIVALILNTKSKG
Uniprot No.

Target Background

Function
The 16 kDa proteolipid subunit 2 (vma-11) is a proton-conducting pore-forming subunit of the membrane integral V0 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Database Links

KEGG: ncr:NCU00667

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the role of vma-11 in the V-ATPase complex of Neurospora crassa?

Vma-11 functions as a proteolipid subunit within the membrane-embedded V0 domain of the V-type proton ATPase complex. This complex plays a critical role in acidifying the lumen of vacuoles and other cellular compartments by hydrolyzing ATP to pump protons across membranes . As part of this machinery, vma-11 contributes to the formation of the proton-conducting channel, working in concert with other V0 domain subunits to facilitate proton translocation. Unlike the VMA-1 subunit (which corresponds to subunit "A" of the V-ATPase and lacks transmembrane domains), vma-11 is a hydrophobic transmembrane protein that directly participates in the proton transport mechanism .

What phenotypes are associated with vma-11 mutations or deletions?

Mutations in vma-11 would likely disrupt V-ATPase assembly or function, leading to defects in vacuolar acidification and consequent impairment of cellular processes dependent on proper pH regulation. These phenotypes may include:

  • Reduced growth rates

  • Altered hyphal morphology

  • Defective protein trafficking and sorting

  • Impaired stress responses, particularly to pH or osmotic challenges

  • Altered vacuolar morphology

A systematic approach to characterizing these phenotypes would involve microscopic analysis of hyphal development, vacuole morphology, and pH-sensitive fluorescent probes to assess compartment acidification.

What are the optimal expression systems for producing recombinant vma-11?

The expression of recombinant vma-11 presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Several expression systems can be considered:

Table 1: Comparison of Expression Systems for Recombinant vma-11

Expression SystemAdvantagesDisadvantagesSpecial Considerations
E. coliRapid growth, high yieldsLack of post-translational modifications, inclusion body formationUse of specialized strains (C41/C43), fusion tags (MBP, SUMO)
Pichia pastorisEukaryotic processing, high-density culturesLonger expression timeMethanol induction optimization
Baculovirus/insect cellsNative-like membrane environmentComplex system, higher costOptimization of virus-to-cell ratio
Neurospora expressionNative environment, proper foldingLower yields, complex purificationHomologous recombination at native locus

When expressing vma-11 in heterologous systems, codon optimization for the host organism is crucial for maximizing protein yield. Additionally, incorporating an N-terminal signal sequence and C-terminal purification tag (such as 6xHis or FLAG) can facilitate proper membrane insertion and subsequent purification.

What purification strategies yield functional recombinant vma-11?

Purification of functional vma-11 requires specialized approaches due to its membrane protein nature:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions containing the recombinant protein.

  • Detergent screening: A critical step involves screening detergents for optimal solubilization while maintaining protein function. Consider:

    • Mild detergents (DDM, LMNG)

    • Lipid-like detergents (CHAPS, digitonin)

    • Novel amphipols or nanodiscs for enhanced stability

  • Affinity chromatography: Utilizing engineered affinity tags (His, FLAG) for initial capture.

  • Size exclusion chromatography: Final polishing step to ensure homogeneity.

The functional state of purified vma-11 can be assessed through reconstitution into proteoliposomes and measuring proton translocation using pH-sensitive fluorescent dyes.

What techniques are most effective for analyzing vma-11 structure-function relationships?

Several complementary approaches can elucidate vma-11 structure-function relationships:

  • Site-directed mutagenesis: Targeting conserved residues in transmembrane domains, particularly those implicated in proton binding or translocation. Key targets include conserved glutamate residues in the transmembrane helices that may participate in the proton relay mechanism.

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine, followed by accessibility testing with thiol-reactive probes to map the transmembrane topology.

  • Cryo-electron microscopy: For visualization of the intact V-ATPase complex with vma-11 in its native environment. This approach has revolutionized membrane protein structural biology.

  • Crosslinking studies: To identify interaction partners and proximity relationships within the V-ATPase complex.

  • Molecular dynamics simulations: Computational approaches to model proton movement through the proteolipid ring.

How can researchers assess the impact of vma-11 mutations on V-ATPase assembly and function?

A methodical approach to studying vma-11 mutations includes:

  • V-ATPase complex assembly analysis: Blue native PAGE to assess intact complex formation or subcomplex accumulation.

  • Co-immunoprecipitation: To evaluate interactions with other V-ATPase subunits.

  • Proton transport assays: Using reconstituted proteoliposomes with pH-sensitive fluorescent dyes (ACMA, pyranine) to directly measure proton pumping activity.

  • In vivo acidification measurements: Using ratiometric pH-sensitive GFP variants targeted to vacuoles to assess compartment acidification in living cells.

  • Growth complementation assays: Testing whether wild-type vma-11 can rescue growth defects in mutant strains under various stress conditions.

Table 2: V-ATPase Activity Assay Methods

Assay TypeMeasurementAdvantagesLimitations
ATP hydrolysisPi releaseQuantitative, high-throughputIndirect measure of proton pumping
Proton transportFluorescence quenchingDirect measure of functionRequires reconstitution
pH measurementsRatiometric fluorescenceIn vivo assessmentComplex calibration
Growth complementationColony formationPhysiological relevanceQualitative, time-consuming

How does vma-11 compare structurally and functionally with other proteolipid subunits in the V-ATPase complex?

The V-ATPase complex in Neurospora crassa contains multiple proteolipid subunits that form the proton-conducting ring in the V0 domain. Vma-11 (16 kDa) shares structural homology with other proteolipid subunits but has distinct features:

  • Structural comparison: While all proteolipid subunits contain multiple transmembrane helices, vma-11 likely forms a specific part of the proteolipid ring that interacts with other V0 and V1 components.

  • Evolutionary conservation: Comparative sequence analysis reveals highly conserved residues across fungal species, particularly in transmembrane domains involved in proton translocation.

  • Functional specialization: Unlike some other proteolipid subunits that may have redundant functions, vma-11 likely plays a non-redundant role in the proper assembly and function of the V-ATPase complex.

To experimentally differentiate the roles of different proteolipid subunits, researchers can employ selective gene deletion followed by complementation with chimeric constructs combining domains from different subunits.

How do environmental and cellular stressors affect vma-11 expression and function?

V-ATPase activity is dynamically regulated in response to cellular conditions. To investigate how stressors affect vma-11:

  • Transcriptional analysis: RT-qPCR and RNA-seq to assess changes in vma-11 mRNA levels under various stress conditions (pH stress, nutrient limitation, osmotic shock, temperature changes).

  • Protein level analysis: Western blotting with specific antibodies to quantify vma-11 protein expression under different conditions.

  • V-ATPase complex assembly/disassembly: Determining whether stressors trigger reversible dissociation of V1 and V0 domains as a regulatory mechanism.

  • Vacuolar morphology: Microscopic analysis of vacuolar system changes in response to stressors, as V-ATPase function is closely linked to vacuolar morphology and function.

  • Post-translational modifications: Investigating whether vma-11 undergoes regulatory modifications such as phosphorylation under different conditions.

What approaches can be used to study vma-11 interactions with other vacuolar proteins?

Several complementary techniques can reveal vma-11's interaction network:

  • Fluorescence microscopy: Similar to studies with VMA-1, researchers can generate strains expressing vma-11 tagged with fluorescent proteins (GFP, mCherry) to visualize co-localization with other tagged proteins . This approach revealed that in N. crassa, VMA-1 co-localizes with NOX-1 in the vacuolar system .

  • Proximity labeling: BioID or APEX2 fusion proteins can identify proximal interaction partners in their native cellular environment.

  • Split-GFP complementation: For detecting direct protein-protein interactions in living cells.

  • Immunoprecipitation coupled with mass spectrometry: To comprehensively identify interaction partners.

  • Förster Resonance Energy Transfer (FRET): For detecting close associations between fluorescently tagged proteins.

How can researchers distinguish between direct and indirect effects when analyzing vma-11 mutant phenotypes?

Disentangling direct from indirect effects requires a systematic approach:

  • Acute inactivation strategies: Using rapid chemical inhibition or optogenetic tools to distinguish immediate effects (likely direct) from adaptive responses (indirect).

  • Suppressor screens: Identifying second-site mutations that rescue vma-11 mutant phenotypes can reveal downstream pathways.

  • Epistasis analysis: Systematically combining vma-11 mutations with mutations in other genes to establish pathway relationships.

  • Targeted rescue experiments: Expressing specific components of potentially affected pathways to determine which defects can be ameliorated.

  • Temporal analysis: Monitoring the progression of phenotypes over time to establish the sequence of events following vma-11 dysfunction.

How conserved is vma-11 across fungal species and what can we learn from comparative studies?

Vma-11 is a highly conserved component of the eukaryotic V-ATPase, reflecting its essential role in cellular physiology:

Table 3: Comparative Features of vma-11 Across Selected Fungal Species

SpeciesSequence Identity to N. crassa (%)Notable Structural FeaturesSpecialized Functions
Saccharomyces cerevisiae~65-70%Additional N-terminal regulatory domainVacuolar acidification, pH homeostasis
Aspergillus nidulans~75-80%Conserved glutamate residues in TM domainsConidiation, stress response
Magnaporthe oryzae~80-85%Extended loop between TM3-TM4Pathogenicity related functions
Candida albicans~60-65%Variant C-terminal domainDimorphic transition, virulence

Comparative analyses reveal:

  • Highly conserved transmembrane domains directly involved in proton translocation

  • More variable N- and C-terminal regions that may interact with species-specific regulatory factors

  • Correlation between specific sequence variations and adaptation to ecological niches

What can heterologous expression studies in different systems tell us about vma-11 function?

Heterologous expression provides valuable insights:

  • Complementation studies: Testing whether N. crassa vma-11 can rescue defects in other fungal species (or vice versa) reveals functional conservation and species-specific adaptations.

  • Chimeric protein analysis: Swapping domains between vma-11 from different species can pinpoint regions responsible for species-specific properties.

  • Expression in mammalian cells: Determining whether fungal vma-11 can integrate into mammalian V-ATPase complexes informs about evolutionary constraints and functional conservation.

  • Xenopus oocyte expression: For electrophysiological studies of proton currents through reconstituted channels containing vma-11.

What are the major challenges in studying recombinant vma-11 and how can they be overcome?

Researchers face several obstacles when working with vma-11:

  • Protein stability issues: As a hydrophobic membrane protein, vma-11 tends to aggregate during purification. Solutions include:

    • Screening multiple detergents or detergent mixtures

    • Using lipid nanodiscs for a more native-like environment

    • Incorporating stabilizing mutations identified through directed evolution

  • Low expression yields: Strategies to improve include:

    • Codon optimization for the expression host

    • Testing different promoter strengths

    • Using fusion partners that enhance folding and stability

    • Lowering expression temperature to allow proper folding

  • Functional reconstitution: Achieving proton pumping activity requires:

    • Co-expression with other V0 subunits

    • Careful lipid composition selection for proteoliposomes

    • Optimized protein-to-lipid ratios

    • Proper orientation in membranes

  • Structural analysis challenges: Approaches include:

    • Crystallization in lipidic cubic phases

    • Cryo-EM of intact complexes

    • NMR studies of isolated transmembrane segments

How can researchers optimize protocols for measuring vma-11 contribution to proton transport?

Measuring the specific contribution of vma-11 to proton transport requires sophisticated approaches:

What are emerging technologies that could advance our understanding of vma-11?

Several cutting-edge approaches hold promise for vma-11 research:

  • Cryo-electron tomography: For visualizing V-ATPase complexes in their native membrane environment at near-atomic resolution.

  • AlphaFold and other AI structure prediction tools: For generating detailed structural models of vma-11 and its interactions within the V-ATPase complex.

  • Single-molecule FRET: To observe conformational changes during the catalytic cycle.

  • Optogenetic tools: For spatiotemporal control of vma-11 function in living cells.

  • CRISPR-based screening: To identify genetic interactions and regulatory networks involving vma-11.

  • Microfluidic platforms: For high-throughput analysis of vma-11 variants and their functional properties.

How might research on vma-11 inform broader understanding of V-ATPase biology across domains of life?

Studies of N. crassa vma-11 contribute to our fundamental understanding of V-ATPase function:

  • Evolutionary conservation: Insights from fungal systems reveal conserved mechanisms applicable to plant and animal V-ATPases.

  • Structural principles: The organization of proteolipid rings informs basic biophysical principles of proton pumping across domains of life.

  • Regulatory mechanisms: Understanding how vma-11 expression and function are regulated may reveal universal principles of V-ATPase regulation.

  • Disease relevance: Insights from fungal vma-11 may inform research on human V-ATPase-related disorders, including osteopetrosis, renal tubular acidosis, and certain neurodegenerative conditions.

  • Drug development: Structural and functional characterization of fungal vma-11 could guide the development of selective inhibitors as potential antifungal agents.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.