Recombinant Neurospora crassa Vacuolar ATPase assembly integral membrane protein VMA21 (vma-21)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Neurospora crassa Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (vma-21) is a protein that is essential for the assembly of V-ATPases . V-ATPases are highly conserved enzymes found in eukaryotic organisms that perform diverse functions . Specifically, VMA21 is required for the assembly of the V0 membrane sector of the V-ATPase but is not a subunit of the final complex .

Function and Role in V-ATPase Assembly

VMA21 functions as an assembly factor protein that is essential for the assembly of the V0 membrane sector of the V-ATPase . V-ATPases are membrane proteins that hydrolyze ATP to pump protons across the membrane, thereby acidifying the lumen of vacuoles and other cellular compartments . VMA21 is localized in the endoplasmic reticulum (ER), and this localization depends on a C-terminal di-lysine motif .

VMA21 interacts with Vma11p and initiates the assembly of the remaining V0 proteolipid subunits, including Vma3p and Vma16p, followed by Vph1p and Vma6p . Additionally, overexpression of Vma21p can compensate for the absence of Pkr1p, which increases the amount of fully assembled V-ATPase present on the vacuole .

Subcellular Localization

In N. crassa, VMA-1, corresponding to subunit "A" of the V-ATPase, has been localized in the entire vacuolar system, which displays a similar pattern to NOX-1 . NOX-1 and VMA-1 co-localize in the same structures, except in the region of large spherical vacuoles, where NOX-1 is localized in the luminal part of the vacuoles and VMA-1 in the periphery .

Experimental Studies and Research Findings

  • Chemogenomic Screening: Large-scale phenotypic analyses have been useful in providing functional clues about uncharacterized yeast genes . Chemogenomic screening of sulfanilamide-hypersensitive mutants revealed that different biological processes, including those involved in vacuole and vesicular transport, DNA metabolic and cell cycle processes, lipid and amino acid metabolism, were compromised by sulfanilamide treatment .

  • Co-localization Studies: Confocal microscopy showed that functional versions of N. crassa NOX-1 display limited co-localization with the ER and early endosomes and are mainly associated with the entire vacuolar system, as defined by the VMA-1 ATPase .

  • Vacuolar System Marker: NOX-1::mCherry co-localizes with the vacuolar system marker carboxy-DFFDA, including the luminal region of the large spherical vacuoles .

Genetic Interactions

A genetic interaction between PKR1 and VMA21 has been observed . Overexpression of Vma21p in cells lacking Pkr1p significantly increased the amount of fully assembled V-ATPase present on the vacuole, suggesting that additional Vma21p can compensate for the loss of Pkr1p .

Relevant Data

ProteinDescriptionFunctionLocalization
VMA21Vacuolar ATPase Assembly Integral Membrane Protein VMA21Required for the assembly of the V0 membrane sector of the V-ATPaseEndoplasmic Reticulum (ER)
VMA-1Subunit “A” of the vacuolar ATPase (V-ATPase)Hydrolyzes ATP to pump protons across the membrane and acidify the lumen of vacuoles and other cell compartmentsEntire vacuolar system
NOX-1NADPH Oxidase NOX-1Associated with the entire vacuolar systemVacuolar system

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your preferred tag type for prioritized development.
Synonyms
vma-21; NCU09107; Vacuolar ATPase assembly integral membrane protein vma-21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
vma-21
Target Protein Sequence
MATRRIISQEKTLLEKDDRIGSSPAASEKSNITPAVPASVIIKLLAFTFAMIVIPISSYF LTVDRLFKGNSTYAGATAAIMANVVLIGYIIVAMAEDQSDQENEKKGGGGKGEGKKDL
Uniprot No.

Target Background

Function
Essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) within the endoplasmic reticulum.
Database Links

KEGG: ncr:NCU09107

Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Neurospora crassa VMA21?

Neurospora crassa VMA21 functions as a chaperone protein essential for the proper assembly of vacuolar ATPase (v-ATPase), a critical proton pump involved in lysosomal acidification. The gene encoding this protein, designated vma-1, contains six small introns (60-131 base pairs) and encodes a hydrophilic protein of 607 amino acids with a molecular weight of approximately 67,121 Da . The protein contains a putative nucleotide-binding region consistent with its role in ATP hydrolysis .

The primary function of VMA21 is to facilitate the assembly of the V0 domain of v-ATPase. In the assembly process, VMA21 initially interacts with subunit c' of the V0 domain, promoting the assembly of proteolipid subunits into a ring structure . Once the V0 domain is fully assembled, VMA21 escorts it to the cis-Golgi where it binds to the V1 sector to form the functional v-ATPase complex . VMA21 contains an ER retention motif (KKXX) that allows it to be transported back to the endoplasmic reticulum to participate in additional rounds of V0 assembly .

How does Neurospora crassa VMA21 compare to its homologs in other species?

In human pathology, mutations in VMA21 cause X-linked myopathy with excessive autophagy (XMEA), a condition characterized by proximal muscle weakness and progressive vacuolation . A zebrafish model with vma21 loss-of-function mutations has been developed that phenocopies human disease manifestations, including impaired motor function, liver dysfunction, and dysregulated autophagy . These comparative studies highlight the fundamental conservation of VMA21 function across species while revealing species-specific adaptations and disease manifestations.

What expression systems are optimal for producing recombinant Neurospora crassa VMA21?

For optimal recombinant expression of Neurospora crassa VMA21, researchers have successfully employed lentiviral expression systems with inducible promoters. A methodological approach involves:

  • Vector construction: The cDNA sequence of VMA21 should be synthesized based on the reference sequence and subcloned into an entry vector (such as pENTR3C), followed by Gateway recombination into an expression vector like pInducer20 .

  • Lentiviral production: Viral particles can be produced in HEK293T cells using packaging systems such as Lenti-X HTX, followed by titration onto the desired cell line .

  • Selection and induction: Stable cell lines are selected using appropriate antibiotics (e.g., puromycin at 1 μg/mL), and expression is induced using agents specific to the chosen promoter system, such as G418 (2 mg/ml) or doxycycline (1 μg/mL) .

  • Verification: Expression should be confirmed at both mRNA and protein levels using qRT-PCR and western blotting, respectively .

This lentiviral approach allows for controlled expression of VMA21 and is particularly valuable for studying the effects of both overexpression and knockdown in various cellular contexts.

What are the critical factors for maintaining proper folding and function of recombinant VMA21?

Maintaining proper folding and function of recombinant VMA21 requires attention to several critical factors due to its role as a membrane-associated assembly factor:

  • Membrane environment: Since VMA21 is an integral membrane protein that functions in the ER and Golgi membranes, expression systems that support proper membrane insertion and folding are essential. Mammalian expression systems may better preserve the native conformation compared to bacterial systems.

  • Post-translational modifications: Any potential glycosylation or other modifications should be preserved by using eukaryotic expression systems.

  • Expression level optimization: Overexpression can lead to protein aggregation or misfolding. Inducible systems allow titration of expression levels to optimize protein production while maintaining proper folding .

  • Verification of functionality: Functional assays should be employed to confirm that recombinant VMA21 retains its ability to facilitate v-ATPase assembly. This can be assessed through complementation studies in VMA21-deficient cells, measuring lysosomal pH, or monitoring autophagy markers such as LC3-I and LC3-II conversion .

  • Storage conditions: Purified recombinant VMA21 should be stored in conditions that maintain membrane protein stability, typically including detergents or lipid environments that mimic its native membrane context.

How can researchers effectively measure VMA21 activity and v-ATPase assembly in vitro?

Measuring VMA21 activity and v-ATPase assembly requires multiple complementary approaches:

  • Lysosomal pH measurement: Since VMA21 is critical for v-ATPase assembly and function, lysosomal acidification serves as an indirect measure of VMA21 activity. This can be assessed using pH-sensitive fluorescent dyes like LysoTracker or LysoSensor, which accumulate in acidic compartments . Quantitative comparisons between wild-type and VMA21-deficient or overexpressing cells provide insight into functional consequences.

  • V-ATPase assembly assay: Co-immunoprecipitation can be used to assess the interaction between VMA21 and V0 domain components, particularly subunit c'. Additionally, sucrose gradient fractionation can separate assembled v-ATPase complexes from unassembled components, with subsequent western blotting to determine the proportion of assembled complexes.

  • ATPase activity measurements: The enzymatic activity of assembled v-ATPase can be measured using colorimetric assays that detect inorganic phosphate released during ATP hydrolysis. Comparison of activity in the presence of specific v-ATPase inhibitors like bafilomycin A1 helps distinguish v-ATPase-specific activity.

  • Autophagic flux assessment: Since VMA21 dysfunction impairs autophagy, measuring autophagic markers provides functional readouts. Western blotting for LC3-I to LC3-II conversion and p62 accumulation, along with fluorescent reporters like GFP-LC3-RFP-LC3ΔG, can quantify autophagic flux alterations .

AssayTechniqueReadoutInterpretation
Lysosomal pHFluorescent dyes (LysoTracker)Fluorescence intensityDecreased signal indicates impaired acidification
V-ATPase AssemblyCo-immunoprecipitationProtein-protein interactionReduced interaction suggests assembly defects
Autophagic FluxGFP-LC3-RFP-LC3ΔG reporterGFP:RFP ratioHigher ratio indicates lower autophagic flux
LC3 ConversionWestern blotLC3-II/LC3-I ratioDecreased ratio suggests impaired autophagy

What phenotypic assays can be used to evaluate VMA21 function in cellular models?

Several phenotypic assays effectively evaluate VMA21 function in cellular models:

  • Cell proliferation and colony formation: VMA21 overexpression has been shown to decrease colorectal cancer cell colony formation, while knockdown promotes proliferation . Standard colony formation assays and growth curve analyses provide quantitative measures of these effects.

  • Electron microscopy for vacuole visualization: Transmission electron microscopy can detect the characteristic autophagic vacuoles that accumulate in cells with VMA21 dysfunction . In VMA21-deficient models, easily identifiable vacuoles with electron-dense material and naked membranes within the vacuole walls are consistent with autophagic vacuoles .

  • Lipid metabolism assessment: Since VMA21 deficiency affects lipid metabolism, assays measuring lipid droplet accumulation (using Oil Red O or BODIPY staining) and cholesterol content can reveal metabolic consequences of VMA21 dysfunction .

  • ER stress markers: VMA21 deficiency triggers ER stress, so measuring the expression of ER stress markers such as BiP/GRP78, CHOP, and XBP1 splicing provides insight into cellular consequences .

  • Muscle differentiation assays: For studying XMEA-related phenotypes, in vitro muscle differentiation assays using patient-derived or engineered myoblasts can reveal defects in the differentiation process associated with VMA21 dysfunction .

How can researchers establish effective disease models for studying VMA21-related pathologies?

Establishing effective disease models for VMA21-related pathologies requires multiple approaches:

  • Patient-derived cell models: Fibroblasts or myoblasts from patients with VMA21 mutations provide valuable primary models. These cells can be differentiated into myotubes to study muscle-specific phenotypes in XMEA . Such models preserve the genetic background and mutation patterns found in patients.

  • CRISPR-Cas9 engineered cellular models: CRISPR-Cas9 technology can be used to introduce specific VMA21 mutations in relevant cell lines, creating isogenic models that differ only in VMA21 status. This approach allows for precise comparison with appropriate controls.

  • Zebrafish models: CRISPR-Cas9 editing has been successfully used to engineer loss-of-function mutations in zebrafish vma21, resulting in phenotypes that mimic human disease including impaired motor function, liver dysfunction, and dysregulated autophagy . These models exhibit lysosomal de-acidification, characteristic autophagic vacuoles in muscle fibers, altered autophagic flux, and reduced lysosomal marker staining .

  • Conditional knockout models: Cell-type specific or inducible knockout models allow for temporal and spatial control of VMA21 deficiency, which is valuable for distinguishing primary effects from secondary consequences.

When establishing these models, it is essential to validate them through:

  • Confirmation of VMA21 expression/activity levels

  • Assessment of v-ATPase assembly and function

  • Verification of key phenotypic features (autophagy defects, lysosomal pH changes)

  • Characterization of tissue-specific manifestations (muscle weakness, liver steatosis)

What therapeutic approaches target VMA21-related dysfunction, and how can they be evaluated in preclinical models?

Several therapeutic approaches show promise for VMA21-related dysfunction:

  • Autophagy modulators: Since VMA21 deficiency impairs autophagy, compounds that enhance autophagy might compensate for this defect. The PI3K inhibitor LY294002 has shown efficacy in improving swim behavior and survival in zebrafish vma21 mutants , potentially by modulating autophagic pathways.

  • Antioxidants: Edaravone, a free radical scavenger, improved motor function and survival in zebrafish vma21 models , suggesting oxidative stress as a contributor to disease pathology that can be therapeutically targeted.

  • Lysosomal pH modulators: Approaches that bypass v-ATPase dependency to normalize lysosomal pH might restore degradative function. This could include ionophores or other compounds that facilitate proton transport across membranes.

  • ER stress reducers: Since VMA21 deficiency triggers ER stress, chemical chaperones or compounds that mitigate ER stress responses might be beneficial .

To evaluate these approaches in preclinical models, researchers should assess:

  • Functional improvements: In zebrafish models, swim behavior and survival provide quantifiable endpoints . In cellular models, restoration of autophagy, reduction in vacuole accumulation, and normalization of lysosomal pH are key parameters.

  • Biochemical markers: Changes in LC3-I/LC3-II ratios, p62 levels, and other autophagy markers can indicate restoration of normal autophagic flux .

  • Tissue-specific improvements: In liver models, reduction in lipid droplet accumulation and normalization of cholesterol metabolism would indicate efficacy . In muscle models, improved differentiation capacity and reduced vacuolation are important endpoints .

  • Dose-response relationships: Establishing dose-response curves helps determine optimal therapeutic windows and potential toxicity thresholds.

How does VMA21 expression change under different cellular stresses, and what regulatory mechanisms control its expression?

Understanding VMA21 regulation under stress conditions provides insights into adaptive responses and potential therapeutic targets. Several methodological approaches can address this question:

  • Transcriptional regulation analysis:

    • qRT-PCR and RNA-seq to quantify VMA21 mRNA levels under various stresses (ER stress, nutrient deprivation, oxidative stress)

    • ChIP-seq to identify transcription factors binding to the VMA21 promoter region

    • Promoter-reporter assays to define regulatory elements controlling VMA21 expression

  • Post-transcriptional regulation:

    • Analysis of VMA21 mRNA stability using actinomycin D chase experiments

    • Investigation of potential microRNA regulation through bioinformatic prediction and functional validation

    • Polysome profiling to assess translational efficiency under stress conditions

  • Protein-level regulation:

    • Pulse-chase experiments to determine VMA21 protein half-life under different conditions

    • Ubiquitination assays to assess potential degradation pathways

    • Subcellular fractionation to track VMA21 localization changes during stress

Preliminary evidence suggests connections between VMA21 function and stress response pathways. For instance, VMA21 deficiency triggers ER stress , potentially establishing a feedback loop where ER stress might in turn affect VMA21 expression. Similarly, since VMA21 is critical for autophagy , and autophagy is upregulated during nutrient deprivation, VMA21 expression might be coordinated with autophagic demands.

Stress ConditionExpected Effect on VMA21Experimental Approach
ER StressPossible upregulationqRT-PCR after tunicamycin treatment
Nutrient DeprivationPotential coordination with autophagyWestern blot during starvation
Lysosomal StressCompensatory responseImmunofluorescence after bafilomycin treatment
Oxidative StressUnknown, possibly protectiveExpression analysis after H₂O₂ exposure

How can high-throughput screening approaches be optimized to identify modulators of VMA21 function?

Optimizing high-throughput screening (HTS) for VMA21 modulators requires developing robust assays with clear readouts related to VMA21 function:

  • Primary screening assays:

    • Lysosomal pH fluorescence assays using pH-sensitive dyes in VMA21-deficient cells, screening for compounds that restore acidification

    • Autophagy reporter systems (GFP-LC3-RFP-LC3ΔG) that provide quantifiable fluorescent readouts of autophagic flux

    • Split-luciferase complementation assays measuring VMA21 interaction with v-ATPase components

  • Assay optimization parameters:

    • Z-factor calculation to ensure statistical robustness

    • Signal-to-background ratio optimization

    • Minimization of well-to-well and plate-to-plate variability

    • DMSO tolerance determination for compound solubilization

  • Secondary validation assays:

    • Dose-response curves to establish potency

    • Cytotoxicity assessment to determine therapeutic windows

    • Target engagement confirmation through thermal shift assays or cellular thermal shift assays (CETSA)

    • Mechanistic studies including western blotting for autophagy markers and electron microscopy for vacuole assessment

  • In vivo validation pipeline:

    • Zebrafish vma21 mutant models provide excellent systems for in vivo validation, as they exhibit quantifiable phenotypes including motor function and survival that respond to drug treatment

    • Compounds improving swim behavior and survival in these models would be prioritized for further development

  • Chemical optimization strategies:

    • Structure-activity relationship (SAR) studies of promising hits

    • Medicinal chemistry optimization for improved pharmacokinetic properties

    • Assessment of specificity through profiling against related pathways

This comprehensive approach would identify compounds that act through different mechanisms, potentially including direct VMA21 stabilizers, v-ATPase assembly enhancers, alternative proton transport facilitators, or modulators of compensatory pathways that bypass VMA21 deficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.