Recombinant New York virus Envelope glycoprotein (GP)

Shipped with Ice Packs
In Stock

Description

Introduction

The "Recombinant New York virus Envelope glycoprotein (GP)" is a genetically engineered protein derived from the envelope of a virus. Viral entry into host cells is often mediated by virally encoded glycoproteins . The envelope glycoprotein complex (GP) is exposed on the surface of the virus as trimeric spikes and is the main target for antibody-based therapeutics and vaccine design . These GPs are crucial for the virus's ability to attach to and enter host cells, making them key targets for vaccines and antiviral therapies .

Marburg Virus Envelope Glycoprotein (GP)

Marburg virus (MARV) contains only one transmembrane protein (GP) which is responsible for receptor recognition on target cells, and triggers viral attachment and entry . In the trans-Golgi network, GP is proteolytically activated by the prohormone convertase furin into two subunits GP(1) and GP(2) . Viral cell entry is a critical point for infection, and as such, this step is targeted for the design of antiviral molecules .

HIV-1 Envelope Glycoprotein

The HIV-1 envelope (Env) is a glycoprotein consisting of a trimer of heterodimers containing gp120 and gp41 subunits that mediates virus entry . The engagement of the HIV-1 gp120 glycoprotein to the host CD4 protein triggers conformational changes in gp120 that allow its binding to co-receptors and is necessary for virus entry to establish infection .

Rift Valley Fever Virus Glycoprotein Gn

Gn is a type I transmembrane protein which forms together with glycoprotein Gc non-covalently linked heterodimers on the lipid bilayer envelope of the virion and allows virus attachment, uptake into cells and Gc mediated cell fusion . The Gn protein consists of an N-terminal ectodomain and a C-terminal transmembrane domain followed by a cytoplasmic tail . The ectodomain is main target for neutralizing antibodies and composed of three domains including an N-terminal helical domain, followed by a β-ribbon and a small globular domain .

Lassa Virus Glycoprotein Complex (GP)

The envelope glycoprotein complex (GP) is exposed on the surface of the Lassa virus as trimeric spikes and is the main target for antibody-based therapeutics and vaccine design . The glycoprotein open reading frame (ORF) codes for an immature precursor polyprotein (referred to as GPC) . A sequence of co- and posttranslational cleavage events by signal peptidase and the host cell convertase SKI-1/S1P generates the glycoprotein subunits stable signal peptide (SSP), GP1 and GP2, which remain associated through non-covalent interactions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP; Envelopment polyprotein; M polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
653-1140
Protein Length
Full Length of Mature Protein
Species
New York virus (NYV)
Target Names
GP
Target Protein Sequence
DTPLMESGWSDTAHGVGIVPMKTDLELDFALASSSSYSYRRKLVNPANKEETLPFHFQLD KQVVHAEIQNLGHWMDGTFNIKTAFHCYGECKKYAYPWQTAKCFFEKDYQYETSWGCNPP DCPGVGTGCTACGVYLDKLRSVGKAYKIVSLKFTRKVCIQLGTEQTCKHIDVNDCLVTPS VKVCLIGTISKLQPGDTLLFLGPLEQGGIILKQWCTTSCVFGDPGDIMSTTTGMKCPEHT GSFRKICGFATTPTCEYQGNTISGFQRMMATRDSFQSFNVTEPHITSNRLEWIDPDSSIK DHINMVLNRDVSFQDLSDNPCKVDLHTQSIDGAWGSGVGFTLVCTVGLTECANFITSIKA CDSAMCYGATVTNLLRGSNTVKVVGKGGHSGSLFKCCHDTDCTEEGLAASPPHLDRVTGY NQIDSDKVYDDGAPPCTIKCWFTKSGEWLLGILNGNWVVVAVLIVILILSILLFSFFCPI RGRKNKSN
Uniprot No.

Target Background

Function

Glycoproteins C and N, located on the virion surface, interact to mediate cell receptor attachment and membrane fusion following virion endocytosis. Glycoprotein C's ITAM motif may dysregulate immune and endothelial cell responses, contributing to viral pathogenesis.

Protein Families
Hantavirus envelope glycoprotein family
Subcellular Location
[Glycoprotein N]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein C]: Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What are the most effective expression systems for recombinant viral envelope glycoproteins?

The choice of expression system significantly impacts:

  • Protein yield and solubility

  • Post-translational modifications

  • Biological activity of the recombinant protein

  • Downstream purification complexity

How do recombinant glycoproteins compare to native viral proteins in immunological assays?

  • Expression system-specific glycosylation patterns

  • Potential conformational differences in recombinant proteins

  • Presence/absence of viral membrane context

For optimal results, validation against positive control sera from confirmed cases is essential, as demonstrated in Gabonese and Zaire patient sample studies with recombinant Ebola glycoproteins .

What methodologies are most effective for analyzing glycoprotein quasispecies diversity in patient samples?

The analysis of viral glycoprotein quasispecies requires specialized molecular techniques to detect variants. Heteroduplex tracking assays (HTA) have proven effective for monitoring envelope diversity, particularly when examining changes over time or in response to immune pressure. This methodology involves:

  • Nested PCR amplification of viral envelope regions (such as V3-V5 regions in HIV)

  • Calibration using known viral templates to establish detection sensitivity

  • Semiquantification by limiting dilution to ensure representative sampling

  • Visual inspection or entropy analysis to assess diversity patterns

For optimal results, researchers should extract viral material from both plasma (for current circulating variants) and peripheral blood mononuclear cells (PBMCs) for integrated proviral DNA, recognizing that new variants appear in the proviral compartment with approximately a 6-week lag time .

How can researchers differentiate between immune-driven selection and natural viral evolution when studying glycoprotein diversity?

Distinguishing immune-driven selection from natural viral evolution requires multifaceted analytical approaches:

  • Baseline characterization of viral quasispecies before immune intervention

  • Temporal tracking of viral diversity over defined intervals

  • Correlation analysis between immune responses and diversity metrics

  • Comparative studies between responders and non-responders to immune interventions

Research with HIV envelope glycoproteins demonstrates that strong vaccine-associated lymphoproliferative immune responses correlate with different patterns of viral diversification compared to weak responses . Notably, contrary to expectations, studies suggest that strong immune responses may sometimes correlate with less viral diversification, challenging the assumption that immune pressure always drives increased viral diversity .

What controls are essential when developing ELISA assays using recombinant viral glycoproteins?

Robust ELISA development using recombinant viral glycoproteins requires a comprehensive control strategy:

  • Positive Controls: Include convalescent sera from confirmed cases of the specific virus being studied, as well as related viruses to assess cross-reactivity. Studies with Ebola recombinant proteins demonstrated effective detection using sera from both homologous (Gabon and Zaire) and heterologous (Côte d'Ivoire) outbreaks .

  • Negative Controls: Use pre-epidemic sera or samples from unexposed populations.

  • Specificity Controls: Include competitive inhibition with soluble recombinant proteins to confirm binding specificity.

  • Cross-Reactivity Assessment: Test against sera containing antibodies to related viral families to evaluate potential false positives.

  • IgG vs. IgM Discrimination: Implement μ-capture ELISA methodologies when detecting IgM antibodies to avoid false positives from rheumatoid factor .

This control framework ensures reliable assay performance for both research applications and potential diagnostic use.

How should researchers design longitudinal studies to track glycoprotein evolution in response to immune pressure?

Effective longitudinal study design for tracking glycoprotein evolution requires:

  • Baseline Sampling: Comprehensive characterization of the viral quasispecies before any intervention, with multiple viral variants typically present at baseline in chronic infections .

  • Temporal Sampling Strategy: Collection at predetermined intervals that account for the replication cycle of the virus and expected mutation rates.

  • Multicompartment Sampling: Analysis of both plasma (for currently replicating virus) and cell-associated viral DNA (for archived variants).

  • Immune Response Correlation: Parallel tracking of humoral and cellular immune responses, particularly lymphoproliferative responses to viral antigens .

  • Quantitative Diversity Metrics: Development of standardized measures for viral diversification, which may include visual inspection of heteroduplex tracking assays or entropy analysis .

Research with HIV-infected individuals demonstrates that most patients show evidence of viral diversification over 6 months of follow-up, with varying patterns that correlate with immune response parameters .

What are the primary limitations of heteroduplex tracking assays (HTA) for glycoprotein diversity analysis?

While heteroduplex tracking assays are valuable tools for assessing viral diversity, researchers should consider several methodological limitations:

  • Signal Intensity Issues: HTA analysis often produces dark images that can complicate entropy analysis, requiring either background removal or Gaussian distribution smoothing for interpretable results .

  • Subjectivity in Visual Analysis: Recent approaches have shifted toward visual inspection methods rather than entropy analysis, introducing potential investigator bias .

  • Sampling Depth Concerns: Accurate representation of the viral quasispecies requires sufficient sampling depth, necessitating semiquantification by limiting dilution to ensure adequate coverage .

  • Compartment Selection Bias: The choice of viral compartment (plasma RNA vs. proviral DNA) influences results, with a known lag time of approximately 6 weeks for new variants to appear in the proviral compartment .

  • Limited Resolution: HTA may not detect minor variants present at frequencies below 1-3% of the population.

To address these limitations, researchers increasingly combine HTA with deep sequencing technologies for more comprehensive diversity assessment.

How do researchers interpret contradictory findings between viral diversity metrics and immune response measurements?

Interpreting paradoxical relationships between immune responses and viral diversity requires nuanced analysis:

  • Temporal Considerations: Assess whether sampling intervals captured the complete evolutionary dynamics following immune pressure.

  • Immune Response Quality vs. Quantity: Differentiate between strong but narrow responses and broader but weaker responses that may exert different selection pressures.

  • Compartmentalization Effects: Consider that diversity in different anatomical compartments may respond differently to systemic immune responses.

  • Fitness Cost Analysis: Evaluate whether immune escape mutations carry fitness costs that limit their persistence.

Research with HIV recombinant glycoprotein vaccines has revealed counterintuitive findings where children with strong vaccine-associated lymphoproliferative responses showed less viral diversification compared to those with weak responses, suggesting that vaccine-elicited immune responses may not exert significant selection pressure on viral quasispecies .

What purification strategies maximize yield and stability of recombinant viral envelope glycoproteins?

Optimizing purification protocols for recombinant viral glycoproteins requires balancing yield, purity, and retention of native conformational epitopes:

  • Affinity-Based Approaches: His-tag purification using nickel-charged resins provides efficient single-step purification for bacterial expression systems, as demonstrated with Ebola virus nucleoprotein .

  • Size Exclusion Chromatography: Secondary purification removes aggregates and improves homogeneity for structural studies.

  • Ion Exchange Chromatography: Particularly useful for separating correctly folded proteins from misfolded variants.

  • Buffering Systems: Optimization should include stability screening across different pH ranges and salt concentrations.

  • Stabilizing Additives: Addition of glycerol (5-10%), sucrose, or specific detergents can enhance long-term stability.

The optimal purification strategy ultimately depends on the specific glycoprotein's characteristics, expression system, and intended downstream applications.

How can researchers design experiments to evaluate the immunogenicity of recombinant glycoproteins?

Comprehensive immunogenicity assessment requires multi-parameter experimental designs:

  • In Vitro Antibody Recognition: ELISA testing with convalescent sera to confirm antigenic similarity to native virus, as performed with Ebola recombinant proteins against sera from multiple outbreaks .

  • Cellular Immunity Evaluation: Lymphoproliferative assays to measure T-cell responses, which have been correlated with viral evolutionary patterns in HIV studies .

  • Epitope Mapping: Identification of immunodominant regions using overlapping peptide arrays or competition assays.

  • Cross-Reactivity Assessment: Testing against heterologous strains to evaluate breadth of responses, as demonstrated with Ebola nucleoprotein reacting with sera from Côte d'Ivoire .

  • Functional Antibody Testing: Neutralization assays or antibody-dependent cellular cytotoxicity (ADCC) assays to assess protective potential.

These methodological approaches provide a comprehensive profile of both the quantity and quality of immune responses generated against recombinant viral glycoproteins.

How do modern techniques for studying viral glycoprotein evolution compare with traditional methods?

Contemporary viral glycoprotein research has evolved significantly beyond traditional approaches:

Traditional MethodsModern TechniquesComparative Advantages
Heteroduplex Tracking Assays (HTA) Next-Generation Sequencing (NGS)NGS provides single-nucleotide resolution and detection of variants at <1% frequency
Bulk PCR and CloningSingle-genome amplificationEliminates PCR recombination artifacts and preserves linkage information
Visual inspection of diversity patterns Computational phylogenetic analysisQuantitative assessment of evolutionary relationships
Limited temporal samplingLongitudinal deep sequencingCaptures evolutionary dynamics and bottleneck events
ELISA-based antibody detection Systems serologyCharacterizes multiple antibody features simultaneously

While newer technologies offer enhanced resolution, traditional methods like HTA remain valuable for rapid assessment of diversity and when resource constraints exist. The experimental question should drive the choice of methodology rather than simply defaulting to the newest technology.

What are the emerging approaches for addressing post-translational modification heterogeneity in recombinant viral glycoproteins?

Glycosylation heterogeneity presents significant challenges for recombinant glycoprotein research. Emerging approaches to address this include:

  • Glycoengineered Expression Systems: Modified insect and mammalian cell lines with humanized glycosylation machinery.

  • Site-Directed Mutagenesis: Selective removal of non-essential glycosylation sites to reduce heterogeneity.

  • Enzymatic Remodeling: In vitro glycosidase treatment followed by chemoenzymatic addition of defined glycans.

  • Glycoproteomic Analysis: Mass spectrometry characterization of site-specific glycosylation profiles to correlate structure with function.

  • Synthetic Biology Approaches: Cell-free expression systems with controlled addition of defined glycosylation components.

These approaches are particularly relevant for envelope glycoproteins where glycan shields play critical roles in immune evasion and receptor binding, as seen in viruses ranging from HIV to coronaviruses.

How should multidisciplinary teams approach viral glycoprotein research to maximize complementary expertise?

Effective multidisciplinary collaboration in viral glycoprotein research requires structured integration of diverse expertise:

  • Core Competency Mapping: Identify essential technical domains including molecular virology, protein biochemistry, immunology, structural biology, and bioinformatics.

  • Standardized Material Exchange: Establish protocols for sharing recombinant proteins, expression constructs, and clinical samples with appropriate quality control metrics.

  • Integrated Data Analysis Pipelines: Develop compatible analytical frameworks that allow correlation between structural, functional, and immunological datasets.

  • Milestone-Based Project Structure: Define clear research phases with decision points for methodology adjustment based on preliminary findings.

  • Cross-Training Initiatives: Implement knowledge transfer sessions to ensure all team members understand methodological limitations and interpretive frameworks across disciplines.

Successful glycoprotein research programs like those studying HIV envelope immunogens demonstrate that integration of virological, immunological, and clinical perspectives yields more comprehensive insights than siloed approaches .

What strategies can optimize reproducibility in recombinant glycoprotein research across different laboratories?

Reproducibility challenges in glycoprotein research can be addressed through:

  • Standard Reference Materials: Development of centralized repositories of well-characterized recombinant proteins and expression constructs.

  • Detailed Protocol Documentation: Publication of complete methodological details including expression conditions, buffer compositions, and storage parameters.

  • Collaborative Validation Studies: Multi-laboratory testing of key findings with standardized protocols and independent analysis.

  • Biological Validation: Confirmation that recombinant proteins exhibit expected biological activities, such as antibody recognition patterns seen with Ebola glycoproteins .

  • Environmental Variable Control: Documentation of critical parameters like temperature fluctuations, freeze-thaw cycles, and lot numbers of key reagents.

Implementation of these practices ensures that findings with recombinant viral glycoproteins can be reliably reproduced, facilitating translation from basic research to applications in diagnostics, vaccines, and therapeutics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.