Recombinant Nickel transport system permease protein nikC (nikC)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Role

NikC is a hydrophobic transmembrane protein that forms part of the nickel-specific ABC transporter complex (Nik system) in bacteria like Escherichia coli, Brucella suis, and Yersinia pseudotuberculosis. The Nik system comprises five subunits:

  • NikA: A periplasmic nickel-binding protein.

  • NikB and NikC: Integral membrane proteins forming the transmembrane channel.

  • NikD and NikE: Membrane-associated ATPases driving nickel uptake.

NikC interacts with NikB to create a pore-like structure that enables nickel ion passage across the cytoplasmic membrane. Its role is critical for nickel acquisition, as demonstrated by studies showing that nikC gene inactivation severely reduces urease activity in B. suis .

PropertyDetailsSource
Protein Length1–277 amino acids (full-length)
Post-Translational TagN-terminal His tag (for purification and structural studies)
Expression SystemE. coli (commonly used for recombinant production)
FunctionForms transmembrane channel with NikB for Ni²⁺ transport

Recombinant Production and Characterization

Recombinant NikC is engineered to include a His tag for affinity purification, enabling structural and functional studies. Key features of its production include:

Functional Studies

  • Heterologous Complementation: E. coli mutants lacking nikA regain urease activity when complemented with B. suis nik genes, including nikC .

  • Nickel Uptake Efficiency: The Nik system (including NikC) exhibits higher nickel transport capacity compared to single-component permeases like UreH in Y. pseudotuberculosis .

Role in Nickel-Dependent Enzymes

NikC’s activity is directly linked to nickel incorporation into urease. In B. suis, nikC mutants show reduced urease activity, restored only by nickel supplementation or genetic complementation . Similarly, Y. pseudotuberculosis mutants lacking the yntABCDE operon (which includes nikC homologs) exhibit near-total loss of urease function .

Redundancy and Regulatory Mechanisms

  • Alternative Transporters: Some bacteria possess dual systems (e.g., ABC transporters and single-component permeases like UreH), ensuring nickel availability under varying conditions .

  • Regulation: Expression of nik operons is often controlled by nickel-responsive regulators (e.g., NikR in E. coli) .

Applications in Biotechnology

Recombinant NikC is utilized in:

  1. Structural Biology: His-tagged NikC facilitates X-ray crystallography and cryo-EM studies to elucidate ABC transporter mechanisms .

  2. Bioremediation: Engineering nickel-accumulating bacteria for heavy metal cleanup.

  3. Antibiotic Development: Targeting nickel transport systems to disrupt pathogen viability.

Table 2: Functional Comparison of NikC with Other Transporters

TransporterTypeNickel AffinitySubstrates
NikC (ABC system)MulticomponentHighNi²⁺
UreHSingle-componentModerateNi²⁺, Co²⁺
CorA/MgtNonspecificLowMg²⁺, Ni²⁺

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be defined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
nikC; Z4870; ECs4345; Nickel transport system permease protein NikC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
nikC
Target Protein Sequence
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
Uniprot No.

Target Background

Function
The NikC protein is involved in a nickel transport system within bacteria. It is believed to facilitate the movement of nickel ions across the bacterial inner membrane.
Database Links

KEGG: ece:Z4870

STRING: 155864.Z4870

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Nickel transport system permease protein nikC in bacterial systems?

Nickel transport system permease protein nikC functions as an integral component of the ATP-binding cassette (ABC) transporter system specialized for nickel uptake in bacterial cells. This transmembrane protein works cooperatively with other Nik system components (typically nikA, nikB, nikD, and nikE) to facilitate the active transport of nickel ions across the cytoplasmic membrane. In this system, nikC forms part of the transmembrane channel through which nickel ions pass .

The protein's structure includes multiple transmembrane domains that anchor it within the cell membrane, creating a pathway specific for nickel ion transport. This selective permeability is critical for maintaining appropriate intracellular nickel concentrations, which are essential for the function of nickel-dependent enzymes such as hydrogenases and ureases in many bacterial species .

How does recombinant nikC differ from native nikC in structural and functional properties?

Functionally, high-quality recombinant nikC with ≥85% purity (as determined by SDS-PAGE) generally retains the ability to form functional channels when reconstituted with other Nik system components . Nevertheless, researchers should verify activity through appropriate functional assays, as expression tags and purification methods may influence protein conformation and membrane insertion capability.

What expression systems are commonly used for producing recombinant nikC protein?

Multiple expression systems have been successfully employed for recombinant nikC production, each offering distinct advantages:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modifications, potential inclusion body formation2-5 mg/L culture
YeastModerate yield, some eukaryotic post-translational modificationsLonger expression time, more complex media requirements1-3 mg/L culture
BaculovirusHigher eukaryotic post-translational modifications, suitable for complex membrane proteinsMore technical expertise required, higher cost1-2 mg/L culture
Mammalian CellFull eukaryotic post-translational modificationsLowest yield, highest cost, longest production time0.5-1 mg/L culture
Cell-Free ExpressionRapid production, avoids toxicity issuesLimited scale, higher cost per mgVariable

Each of these systems can typically achieve ≥85% purity as determined by SDS-PAGE following appropriate purification protocols . The selection of expression system should be determined by the specific experimental requirements, particularly if functional studies are planned.

What are the optimal conditions for expressing soluble and functional recombinant nikC protein?

Achieving optimal expression of soluble and functional recombinant nikC requires careful consideration of multiple parameters:

For prokaryotic expression systems (E. coli):

  • Use specialized strains designed for membrane protein expression (C41(DE3), C43(DE3), or Lemo21(DE3))

  • Employ lower induction temperatures (16-20°C) to reduce inclusion body formation

  • Utilize weaker promoters or reduced inducer concentrations (0.1-0.5 mM IPTG rather than standard 1.0 mM)

  • Supplement growth media with 5-10 μM NiCl₂ to stabilize the forming protein

  • Consider co-expression with chaperone proteins to aid proper folding

For eukaryotic systems:

  • Optimize codon usage for the expression host

  • Include appropriate signal sequences to direct proper membrane targeting

  • Employ detergent screening to identify optimal solubilization conditions

When designing experimental approaches, a factorial design can be employed to systematically test these variables and their interactions, as recommended in standard experimental design practices for the life sciences . This approach ensures that the complex interplay between these factors is appropriately accounted for in optimization protocols.

What purification strategies yield the highest purity and activity of recombinant nikC?

Purification of recombinant nikC to ≥85% purity while maintaining functional activity requires a multi-step approach tailored to membrane proteins:

  • Membrane Isolation and Solubilization:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membrane fractions via ultracentrifugation (100,000 × g, 1 hour)

    • Screen detergents for optimal solubilization (common options include n-dodecyl-β-D-maltopyranoside (DDM), n-decyl-β-D-maltopyranoside (DM), or digitonin)

  • Affinity Chromatography:

    • For His-tagged constructs, use Ni-NTA columns with imidazole gradient elution

    • Include detergent at concentrations above critical micelle concentration throughout purification

    • Consider using larger bed volumes than typically used for soluble proteins

  • Size Exclusion Chromatography:

    • Further purify using Superdex 200 or similar matrices

    • Assess oligomeric state and homogeneity

    • Confirm ≥85% purity via SDS-PAGE as standard for research-grade material

  • Functional Validation:

    • Reconstitute into proteoliposomes for transport assays

    • Verify nickel transport capability using radioactive nickel isotopes or fluorescent indicators

This systematic approach, incorporating principles of experimental design for the life sciences, ensures both purity and functional integrity of the recombinant protein .

What methods are most effective for verifying the structure and function of purified recombinant nikC?

Multiple complementary techniques should be employed to comprehensively characterize recombinant nikC structure and function:

Structural Characterization:

Functional Validation:

  • Proteoliposome Reconstitution: Incorporate purified nikC into artificial liposomes

  • Transport Assays: Measure ⁶³Ni uptake rates in proteoliposomes

  • ATPase Coupling Assays: When reconstituted with nikD/nikE, verify ATP-dependent transport

Quality Control Assessments:

  • SDS-PAGE and Western Blotting: Confirm identity and assess purity (≥85% as standard)

  • Size Exclusion Chromatography: Verify homogeneity and absence of aggregation

  • Thermal Shift Assays: Evaluate protein stability in various buffer conditions

These methodological approaches, while technically demanding, provide robust verification of both structural integrity and functional activity of the recombinant protein, following best practices in experimental design for membrane protein research .

How can recombinant nikC be effectively utilized in structural biology studies?

Structural studies of recombinant nikC require specialized approaches given its nature as a membrane protein:

X-ray Crystallography Approaches:

  • Screen detergent and lipid combinations systematically to identify conditions promoting crystal formation

  • Consider lipidic cubic phase (LCP) crystallization, which often succeeds for membrane proteins resistant to traditional methods

  • Explore co-crystallization with antibody fragments or designed ankyrin repeat proteins (DARPins) to increase polar surface area

  • Employ surface entropy reduction mutations to enhance crystallizability

Cryo-EM Strategies:

  • Utilize amphipols or nanodiscs to maintain native-like membrane environment

  • Consider GraFix (gradient fixation) method to stabilize oligomeric assemblies

  • Employ different grid types and preparation conditions to optimize particle distribution

Complementary Approaches:

  • NMR studies of specific domains or with isotopically labeled protein

  • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions

  • Molecular dynamics simulations based on homology models to predict structure-function relationships

Each of these methodologies provides unique structural insights, and their combination offers the most comprehensive structural understanding of nikC and its membrane topology and functional mechanisms .

What are the key considerations when designing mutational studies of nikC to investigate structure-function relationships?

Designing effective mutational studies for nikC requires strategic targeting of residues based on predicted functional importance:

Site Selection Strategy:

  • Target conserved residues across nikC homologs from different bacterial species

  • Focus on charged residues within predicted transmembrane domains that may form the ion conduction pathway

  • Investigate the interface between nikC and other components of the nickel transport system (nikB, nikD, nikE)

  • Examine potential metal coordination sites based on structural predictions

Mutation Design Principles:

  • Create conservative substitutions to assess the importance of specific chemical properties

  • Employ alanine-scanning mutagenesis for systematic functional mapping

  • Design charge-reversal mutations to test electrostatic interactions

  • Generate cysteine substitutions for accessibility studies and cross-linking experiments

Functional Assessment Framework:

  • Establish a standardized reconstitution protocol for consistent assessment

  • Develop quantitative transport assays with appropriate controls

  • Compare kinetic parameters (Km, Vmax) between wild-type and mutant proteins

  • Assess changes in substrate specificity through competition studies

This systematic approach, incorporating proper experimental controls and replications as emphasized in standard experimental design practices, enables robust structure-function analysis while minimizing experimental artifacts .

How can nikC function be studied in relation to the complete nickel transport system?

Understanding nikC in the context of the complete nickel transport system requires integrated approaches:

Reconstitution of Complete Transport Systems:

  • Co-express and co-purify nikABCDE components to maintain native interactions

  • Develop methods to verify proper stoichiometry and assembly

  • Establish proteoliposome systems that recapitulate directional transport

Interaction Studies:

  • Employ co-immunoprecipitation or pull-down assays to identify stable interactions

  • Use crosslinking coupled with mass spectrometry to map interaction interfaces

  • Perform FRET or BRET studies in native membrane environments to assess dynamic interactions

Functional Integration Assessment:

  • Measure ATP hydrolysis coupled to nickel transport

  • Determine the effect of substrate binding to nikA on the activity of the membrane components

  • Investigate regulatory mechanisms through systematic deletions or mutations of system components

In vivo Validation Approaches:

  • Develop complementation assays in bacterial strains lacking functional nik components

  • Create reporter systems to monitor intracellular nickel concentrations

  • Assess physiological outcomes (growth, enzyme activity) under nickel limitation

These comprehensive approaches allow researchers to place nikC function within its broader biological context, following best practices in experimental design for complex biological systems .

What strategies can address low expression or insolubility issues with recombinant nikC?

When encountering expression or solubility challenges with recombinant nikC, researchers can implement several targeted interventions:

Expression Optimization:

  • Screen multiple E. coli strains specifically designed for membrane proteins (C41, C43, Lemo21)

  • Test expression under osmotic stress conditions (addition of 0.5M sorbitol and 4mM betaine)

  • Reduce expression temperature to 16-18°C with extended induction times (16-24 hours)

  • Utilize auto-induction media to provide gradual protein expression

  • Consider switching to alternative expression systems if E. coli consistently fails

Solubility Enhancement:

  • Systematically screen a panel of at least 8-12 detergents for optimal solubilization

  • Explore fusion partners specifically designed for membrane proteins (Mistic, SUMO)

  • Test the addition of specific lipids during solubilization (E. coli total lipid extract, specific phospholipids)

  • Optimize buffer conditions (pH range 6.5-8.0, salt concentration 100-500 mM)

Expression Construct Modifications:

  • Redesign constructs to remove potential problematic regions

  • Create truncated versions focusing on specific domains

  • Optimize codon usage for the expression host

  • Remove or reposition affinity tags that may interfere with membrane insertion

This systematic troubleshooting approach follows principles of good experimental design, where variables are changed one at a time with appropriate controls to identify optimal conditions .

How can researchers troubleshoot non-functional recombinant nikC despite successful expression and purification?

When recombinant nikC shows poor functionality despite successful expression and purification, several methodological approaches can identify and address the underlying issues:

Protein Quality Assessment:

  • Verify proper folding using limited proteolysis patterns compared to native protein

  • Assess thermal stability using differential scanning fluorimetry

  • Check for aggregation using dynamic light scattering

  • Examine oligomeric state via crosslinking or native PAGE

Reconstitution Optimization:

  • Screen lipid compositions systematically to identify optimal membrane environment

  • Test different protein-to-lipid ratios (typically 1:50 to 1:500 w/w)

  • Compare different reconstitution methods (detergent dialysis, direct incorporation, freeze-thaw cycles)

  • Verify protein orientation in proteoliposomes using protease protection assays

Functional Assay Refinement:

  • Ensure assay conditions match physiological requirements (pH, ionic strength)

  • Verify the presence of essential cofactors or partners (other Nik system components)

  • Test functionality under various membrane potential conditions

  • Develop more sensitive detection methods for transport activity

System Integration Checks:

  • Confirm proper assembly with other components of the transport system

  • Verify stoichiometry of reconstituted complexes

  • Test functionality in complementation assays using nik-deficient bacterial strains

This structured approach to troubleshooting follows good experimental design principles, systematically identifying and addressing potential points of failure .

What quality control standards should be applied to ensure experimental reproducibility when working with recombinant nikC?

Ensuring reproducibility in recombinant nikC research requires rigorous quality control standards:

Protein Production Quality Controls:

  • Establish minimum purity criteria (≥85% as indicated by SDS-PAGE)

  • Implement batch-to-batch consistency checks using chromatographic profiles

  • Verify protein identity through mass spectrometry or N-terminal sequencing

  • Assess endotoxin levels when preparing protein for cell-based assays

Functional Validation Standards:

  • Develop standard functional assays with defined acceptance criteria

  • Include positive and negative controls in every experiment

  • Establish minimum activity thresholds for proceeding with experiments

  • Implement regular stability testing protocols for stored protein preparations

Experimental Design Considerations:

  • Follow proper randomization and blinding procedures where applicable

  • Include technical replicates (minimum n=3) for all critical measurements

  • Plan for biological replicates across independent protein preparations

  • Calculate appropriate sample sizes based on expected effect magnitudes and variability

Documentation Requirements:

  • Maintain detailed records of expression conditions and purification procedures

  • Document all buffer compositions and storage conditions

  • Record lot numbers of critical reagents and materials

  • Implement standardized reporting formats for experimental results

These quality control measures align with best practices in experimental design for the life sciences, ensuring that research findings are robust and reproducible .

How should researchers analyze and interpret kinetic data from nikC transport assays?

Kinetic analysis of nikC-mediated transport requires specialized approaches for membrane transport systems:

Data Collection Protocols:

  • Measure initial transport rates across multiple substrate concentrations (typically 6-8 concentrations spanning 0.1-10× expected Km)

  • Collect time-course data with sufficient early time points to establish true initial rates

  • Include appropriate controls (non-functional nikC mutants, liposomes without protein)

  • Ensure consistent protein-to-lipid ratios across experiments

Kinetic Model Selection:

  • Determine appropriate kinetic model (Michaelis-Menten, Hill equation for cooperativity)

  • Consider more complex models if simple models fail to fit the data

  • Test for substrate inhibition at higher concentrations

  • Account for potential counterion effects

Parameter Estimation Methods:

  • Utilize non-linear regression rather than linearization methods

  • Calculate confidence intervals for all kinetic parameters

  • Compare parameters across multiple independent preparations

  • Assess goodness-of-fit using appropriate statistical methods

Comparative Analysis Framework:

  • Establish wild-type parameters as baseline for comparison

  • Create normalized representation of mutant activities

  • Develop structure-function correlations based on kinetic perturbations

  • Consider thermodynamic constraints on the transport process

This systematic approach to kinetic analysis ensures accurate interpretation of transport data and facilitates meaningful comparison across experimental conditions, following principles of good experimental design .

What bioinformatic approaches can provide insights into nikC function and evolution?

Bioinformatic analysis offers powerful tools for understanding nikC within broader biological contexts:

Sequence Analysis Strategies:

  • Perform multiple sequence alignments across diverse bacterial species

  • Identify invariant residues as candidates for essential functional roles

  • Map conservation patterns onto predicted structural models

  • Compare orthologous sequences to reveal species-specific adaptations

Structural Prediction Methods:

  • Generate homology models based on related transporter structures

  • Utilize specialized membrane protein threading algorithms

  • Employ molecular dynamics simulations to predict conformational changes

  • Validate models through comparison with experimental data

Genomic Context Analysis:

  • Examine operonic organization across bacterial species

  • Identify co-evolving proteins through phylogenetic profiling

  • Analyze promoter regions for regulatory elements

  • Investigate horizontal gene transfer patterns

Functional Network Integration:

  • Connect nikC to broader nickel homeostasis networks

  • Identify potential regulatory interactions

  • Predict functional consequences of nikC perturbation

  • Compare with other metal transport systems for mechanistic insights

These complementary bioinformatic approaches provide a comprehensive framework for understanding nikC evolution, structure, and function, generating testable hypotheses for experimental validation and following principles of thorough research design .

How can researchers effectively combine structural and functional data to develop a comprehensive model of nikC function?

Developing an integrated model of nikC function requires systematic integration of diverse experimental datasets:

Data Integration Framework:

  • Create a hierarchical data organization system prioritizing direct experimental evidence

  • Distinguish between high-confidence structural features and predicted elements

  • Develop a consistent nomenclature for structural features and functional states

  • Establish clear connections between structural elements and kinetic parameters

Structural-Functional Correlation Methods:

  • Map functional defects of mutations onto structural models

  • Identify conformational changes associated with transport cycles

  • Correlate accessibility data with predicted transmembrane topology

  • Analyze conservation patterns in the context of structural models

Model Development Approach:

  • Begin with simplified models and progressively incorporate complexity

  • Test models against independently acquired datasets

  • Refine models to resolve inconsistencies between datasets

  • Explicitly identify assumptions and limitations of current models

Model Validation Strategies:

  • Design experiments specifically to test model predictions

  • Develop quantitative predictions that can be experimentally verified

  • Compare predictions across different experimental systems

  • Critically evaluate alternative explanations for observed phenomena

This systematic integration of structural and functional data, following principles of thorough experimental design, provides the most comprehensive understanding of nikC function within the nickel transport system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.