Recombinant Nicotiana alata Probable aquaporin NIP-type

Shipped with Ice Packs
In Stock

Description

Production Parameters

ParameterSpecification
Host organismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder (Tris/PBS-based buffer, 6% trehalose, pH 8.0)
Storage-20°C/-80°C (aliquots with 50% glycerol recommended)

Applications in Research

  • SDS-PAGE: Used to verify purity and molecular weight .

  • ELISA: Serves as an antigen for antibody production or detection .

  • Functional assays: Potential use in yeast-based screens to test solute transport (e.g., urea, boric acid) .

Substrate Specificity

NIP aquaporins are known to transport small neutral solutes, including:

  • Glycerol: Observed in NIP I/II subfamilies .

  • Boric acid (BA): Transported by NIP II/III members (e.g., NtNIP5;1 in tobacco) .

  • Urea: Permeability linked to NIP III aquaporins .

Table 2: NIP Subfamilies and Potential Substrates

SubfamilyKey FeaturesInferred Substrates
NIP I/IIBoron-permeable (e.g., AtNIP5;1)Boric acid, urea
NIP IIIBroad solute selectivityGlycerol, silicon, urea

Tissue and Subcellular Localization

  • Tissue specificity: Pollen-specific expression .

  • Membrane localization: Likely plasma membrane or tonoplast, based on homology to NtNIP2;1 and NtNIP5;1 .

Role in Plant Stress Responses

NIP aquaporins are critical for:

  • Osmoregulation: Maintaining cellular water balance under drought or salinity .

  • Nutrient uptake: Transporting micronutrients (e.g., boron, silicon) .

  • Reproductive processes: Pollen hydration and germination, as observed in Arabidopsis SIPs .

Potential Applications

  • Agricultural biotechnology: Engineering NIP aquaporins to enhance stress tolerance in crops .

  • Protein interaction studies: Exploring interactions with membrane proteins or transport regulators .

Limitations of Current Data

  • Functional validation: Direct experimental evidence for substrate specificity of the Nicotiana alata NIP-type is lacking.

  • Structural dynamics: Limited 3D structural data compared to PIP and TIP subfamilies .

Future Research Priorities

  1. Functional assays: Yeast-based screens to confirm solute permeability.

  2. Localization studies: GFP fusions to determine membrane localization in planta.

  3. Evolutionary analysis: Comparative genomics with NIP homologs in other Nicotiana species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Probable aquaporin NIP-type; Pollen-specific membrane integral protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Nicotiana alata (Winged tobacco) (Persian tobacco)
Target Protein Sequence
MAKKDGNQEEEISQMEEGNIHSASNSDSNVGFCSSVSVVVILQKLIAEAIGTYFVIFAGCGSVAVNKIYGSVTFPGICVTWGLIVMVMVYTVGYISGAHFNPAVTITFSIFGRFPWKQVPLYIIAQLMGSILASGTLALLFDVTPQAYFGTVPVGSNGQSLAIEIIISFLLMFVISGVATDDRAIGQVAGIAVGMTITLNVFVAGPISGASMNPARSIGPAIVKHVYTGLWVYVVGPIIGTLAGAFVYNLIRSTDKPLRELAKSASSLRS
Uniprot No.

Target Background

Function
Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Protein Families
MIP/aquaporin (TC 1.A.8) family, NIP (TC 1.A.8.12) subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Pollen specific.

Q&A

What is Recombinant Nicotiana alata Probable Aquaporin NIP-Type Protein?

Recombinant Nicotiana alata Probable aquaporin NIP-type protein (UniProt ID: P49173) is a full-length (270 amino acid) channel protein belonging to the NIP (Nodulin-26-like Intrinsic Proteins) subfamily of plant aquaporins. This protein, also referred to as "Pollen-specific membrane integral protein," functions as a membrane channel involved in the selective transport of water and specific solutes . The recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and is produced in expression systems such as E. coli for research applications .

Aquaporins (AQPs) represent a diverse family of multifunctional membrane proteins that have expanded considerably throughout plant evolution, creating dynamic solute transport networks across various cellular membranes. These proteins facilitate the movement of water and vital solutes, playing crucial roles in numerous plant physiological processes .

What Expression Systems Are Recommended for Producing Functional Recombinant NIP-Type Aquaporins?

Several expression systems have been successfully employed for producing recombinant Nicotiana alata NIP-type aquaporins, each with specific advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modifications
YeastEukaryotic processing, suitable for functional studiesSlower than bacterial expression
BaculovirusHigher-order eukaryotic processingMore complex setup, moderate yield
Mammalian CellNative-like post-translational modificationsHigher cost, lower yield
Cell-Free ExpressionRapid production, avoids toxicity issuesLower yield, higher cost

For functional characterization studies, yeast expression systems are particularly valuable as demonstrated in studies of other plant aquaporins, allowing for high-throughput functional screens to identify substrate specificity .

How Can Researchers Design Functional Assays to Characterize NIP-Type Aquaporin Transport Properties?

Functional characterization of NIP-type aquaporins can be achieved through several complementary approaches:

Yeast-Based Functional Screens:
Yeast expression systems lacking endogenous aquaporins (e.g., aqy1 aqy2 deletion strains) provide an excellent platform for characterizing transport properties. Assays that have proven effective include:

  • Water Transport Assessment: Freeze-thaw survival assays measure the protective effects of functional water-transporting aquaporins. After expression in yeast, cells are subjected to freeze-thaw cycles, and survival rates are quantified through growth measurements. NIP-type aquaporins with water transport activity would show increased survival compared to empty vector controls .

  • Boric Acid Transport: Boric acid toxicity assays utilize the fact that increased boric acid uptake will enhance toxicity in yeast. Transformed yeast are grown in media containing increasing concentrations of boric acid (typically 10-30mM), and growth inhibition is measured relative to controls. NIP-type aquaporins that transport boric acid will show enhanced sensitivity to boric acid exposure .

  • Hydrogen Peroxide Transport: H₂O₂ sensitivity assays expose transformed yeast to increasing concentrations of H₂O₂ (0.25-1mM). Aquaporins permeable to H₂O₂ will show reduced growth at lower H₂O₂ concentrations compared to controls .

  • Urea Transport: Growth-based assays using urea as the sole nitrogen source can identify urea-transporting aquaporins, with enhanced growth indicating functional transport .

What Approaches Are Effective for Investigating NIP-Type Aquaporin Localization in Plant Cells?

Understanding the subcellular localization of NIP-type aquaporins is essential for interpreting their physiological roles. Effective methodologies include:

  • GFP Fusion Proteins: Creating translational fusions between the NIP-type aquaporin and GFP allows for direct visualization of localization in plant cells. This approach has successfully demonstrated that various plant aquaporins localize to different membranes including the plasma membrane, tonoplast, and endoplasmic reticulum .

  • Immunolocalization: Using specific antibodies raised against the NIP-type aquaporin for immunofluorescence microscopy or immunogold electron microscopy provides high-resolution localization data without the need for protein fusion.

  • Membrane Fractionation: Biochemical separation of different cellular membranes followed by Western blot analysis using specific antibodies can confirm the presence of the NIP-type aquaporin in particular membrane fractions.

For optimal results, researchers should combine multiple approaches to verify localization findings, as each method has inherent limitations .

How Do NIP-Type Aquaporins Contribute to Plant Water Relations and Stress Responses?

NIP-type aquaporins play significant roles in plant water relations and stress responses through their transport activities. Studies with tobacco aquaporins have revealed their importance:

  • Water Transport Contribution: Antisense plants with inhibited aquaporin expression show reduced root hydraulic conductivity and lower water stress resistance, indicating that aquaporin-mediated symplastic water transport is crucial for whole-plant water relations .

  • Boron Nutrition: NIP-type aquaporins can transport boric acid, an essential micronutrient. Studies of NIP homologs (such as AtNIP5;1) have shown they facilitate boron uptake and distribution within the plant, affecting growth under boron-limiting conditions .

  • Reactive Oxygen Species Signaling: The ability of some NIP-type aquaporins to transport H₂O₂ suggests a potential role in ROS signaling during stress responses .

When investigating the contribution of NIP-type aquaporins to stress responses, researchers should consider physiological parameters including:

  • Root and shoot hydraulic conductivity

  • Transpiration rate measurements

  • Water potential in different plant tissues

  • Growth analyses under water-limited conditions

  • Nutrient status related to transported substrates (e.g., boron)

What Structural Features Determine Substrate Selectivity in NIP-Type Aquaporins?

Substrate selectivity in NIP-type aquaporins is primarily determined by specific structural features:

  • Aromatic/Arginine (ar/R) Selectivity Filter: This constriction region, formed by specific amino acids from transmembrane helices 2 and 5 and two loop regions, largely determines which substrates can permeate through the aquaporin. Variations in this site create different pore sizes and chemical environments that favor transport of specific substrates .

  • NPA Motifs: The dual Asn-Pro-Ala (NPA) motifs located at the center of the pore create a second constriction point. Variations in residue composition around these motifs contribute to selectivity for substrates such as ammonia, boric acid, and urea .

  • Pore Diameter and Shape: AlphaFold protein models have illustrated differences in pore shape and size across aquaporin subfamilies, which affects which molecules can pass through .

NIP-type aquaporins are categorized into subclasses (NIP I, NIP II, NIP III) based on structural features that correlate with different transport specificities. For example, NIP II subclass members (like NtNIP5;1s) are typically permeable to boron, while NIP III subclass members (like NtNIP2;1s) can transport diverse metalloid compounds including both boron and silicon .

How Does Tetramer Composition Affect NIP-Type Aquaporin Function?

Aquaporins function as tetramers, and the composition of these tetramers can significantly impact their functional properties:

  • Homotetramer vs. Heterotetramer Function: Studies with other plant aquaporins (PIP subfamily) have shown that tetramer composition affects transport activity. For example, when NtAQP1 (a PIP1 aquaporin) and NtPIP2;1 (a PIP2 aquaporin) form heterotetramers, their functional properties are modified compared to homotetramers .

  • Cooperative Effects: Research has demonstrated that in some cases, a single functional aquaporin within a tetramer is sufficient to significantly increase water permeability, while for other functions (like CO₂ transport), maximum rates occur only with specific tetramer compositions .

  • Membrane Trafficking Effects: Heterotetramerization can also affect membrane integration and trafficking of aquaporins. When some PIP1 and PIP2 aquaporins are coexpressed, membrane integration is more effective, which consequently increases measured transport rates .

To investigate heterotetramerization of NIP-type aquaporins, researchers can employ:

  • Split YFP experiments to visualize protein-protein interactions

  • Protein chromatography to isolate and characterize multimeric complexes

  • Blue native gel electrophoresis to analyze intact protein complexes

  • Co-immunoprecipitation to identify interacting partners

These approaches can help determine whether NIP-type aquaporins form heterotetramers with other aquaporins and how this affects their function .

What Controls Should Be Included When Characterizing Recombinant NIP-Type Aquaporins?

Proper experimental controls are essential for reliable characterization of recombinant NIP-type aquaporins:

  • Expression Controls:

    • Empty vector transformants to establish baseline responses

    • Western blot analysis to confirm protein expression levels

    • Positive control aquaporins with known transport activities

    • Negative control aquaporins lacking specific transport functions

  • Functional Assay Controls:

    • Untreated samples to establish baseline growth or responses

    • Concentration gradients of test substrates to determine sensitivity thresholds

    • Time-course measurements to capture dynamic responses

    • Pharmacological inhibitors of aquaporin function (e.g., mercury compounds) to confirm channel-mediated transport

  • Localization Controls:

    • Free fluorescent protein (without fusion) to distinguish between targeted and non-specific localization

    • Known markers for specific cellular compartments

    • Pre-immune serum controls for immunolocalization studies

These controls help distinguish true NIP-type aquaporin-mediated effects from background responses and non-specific effects .

What Methods Are Recommended for Investigating Structure-Function Relationships in NIP-Type Aquaporins?

Understanding structure-function relationships in NIP-type aquaporins requires a multifaceted approach:

  • Computational Modeling:

    • AlphaFold protein models to predict 3D structure

    • Molecular dynamics simulations to investigate pore dynamics

    • Comparative modeling using known aquaporin structures

    • In silico mutagenesis to predict effects of amino acid substitutions

  • Site-Directed Mutagenesis:

    • Targeted modification of residues in the selectivity filter (ar/R region)

    • Alterations to NPA motifs and surrounding residues

    • Creation of chimeric proteins by swapping domains between aquaporins with different substrate specificities

  • Functional Assessment of Mutants:

    • Transport assays in heterologous systems (yeast, oocytes)

    • Measurement of transport kinetics for various substrates

    • Determination of inhibitor sensitivity profiles

By systematically altering key structural elements and measuring the resulting changes in transport properties, researchers can identify the specific amino acid residues that determine substrate selectivity and transport efficiency in NIP-type aquaporins .

How Can Researchers Address Challenges in Purification and Stability of Recombinant NIP-Type Aquaporins?

Membrane proteins like NIP-type aquaporins present specific challenges for purification and stability. Effective strategies include:

  • Optimized Solubilization:

    • Screen multiple detergents (DDM, OG, LMNG, etc.) for efficient extraction from membranes

    • Consider nanodiscs or SMALPs for maintaining a native-like lipid environment

    • Test different detergent:protein ratios to maximize yield while maintaining function

  • Purification Optimization:

    • Take advantage of the His-tag for IMAC purification under optimized conditions

    • Consider size-exclusion chromatography to isolate tetrameric complexes

    • Implement quality control steps using analytical techniques (SEC-MALS, DLS)

  • Stability Enhancement:

    • Include appropriate lipids during purification and storage

    • Add stabilizing agents such as glycerol (recommended at 5-50% final concentration)

    • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

    • Reconstitute in appropriate buffers (typically Tris/PBS-based, pH 8.0)

For optimal results with the recombinant Nicotiana alata NIP-type protein, it is recommended to briefly centrifuge the vial before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, add glycerol to a final concentration of 5-50%, and store aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How Can NIP-Type Aquaporin Studies Contribute to Understanding Plant Adaptation to Environmental Stresses?

Research on NIP-type aquaporins provides valuable insights into plant adaptation mechanisms:

  • Water Deficit Responses:

    • NIP-type aquaporins may contribute to cellular water homeostasis during drought

    • Expression patterns under water stress can reveal adaptive regulation

    • Antisense plants with inhibited aquaporin expression show reduced water stress resistance, confirming their role in adaptation

  • Nutrient Acquisition:

    • NIP-type aquaporins that transport boric acid are critical for boron nutrition

    • Understanding transport mechanisms can help explain adaptation to variable nutrient availability

    • NIP subfamilies with differing substrate specificities may reflect adaptation to different ecological niches

  • Evolutionary Perspective:

    • The diversification of aquaporins in plants reflects adaptation to terrestrial environments

    • Comparative studies across species can reveal how NIP-type aquaporins have evolved specialized functions

    • Analysis of expression patterns in different tissues can indicate functional specialization

By integrating NIP-type aquaporin research with ecophysiological studies, researchers can better understand how these proteins contribute to plant adaptation across diverse environments .

What Methodological Approaches Can Connect Molecular Characteristics to Whole-Plant Physiology?

Bridging the gap between molecular-level understanding of NIP-type aquaporins and whole-plant physiology requires integrated approaches:

  • Transgenic Plant Studies:

    • Create plants with altered NIP-type aquaporin expression (overexpression, knockdown, knockout)

    • Analyze phenotypic effects under various environmental conditions

    • Measure physiological parameters including hydraulic conductivity, transpiration, and growth

  • Multi-Scale Analysis:

    • Combine cellular localization studies with tissue-level hydraulic measurements

    • Correlate protein abundance with physiological responses

    • Integrate data from different organizational levels (molecular, cellular, tissue, whole-plant)

  • Environmental Response Profiling:

    • Monitor expression of NIP-type aquaporins under various stresses

    • Correlate expression changes with physiological adaptations

    • Compare responses across different plant species or ecotypes

Research has demonstrated that tobacco plants impaired in aquaporin expression showed reduced root hydraulic conductivity and lower water stress resistance, providing a clear link between molecular function and whole-plant physiology .

By systematically connecting molecular characteristics to physiological responses, researchers can develop a comprehensive understanding of how NIP-type aquaporins contribute to plant function and adaptation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.