Recombinant Nicotiana debneyi Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preferences when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimations, please consult your local distributors.
Note: All our proteins are standardly shipped with regular blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend a brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate with us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Nicotiana debneyi (Debney's tobacco)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Photosystem Q(B) protein and what is its function in photosynthesis?

The Photosystem Q(B) protein (EC 1.10.3.9), also called Photosystem II protein D1, is a critical 32 kDa thylakoid membrane protein encoded by the psbA gene in Nicotiana debneyi (Debney's tobacco) . It functions as a core component of Photosystem II, where it binds plastoquinone at the QB site and facilitates electron transport during the light-dependent reactions of photosynthesis. The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane and plays a central role in water-splitting and oxygen evolution during photosynthesis. Its amino acid sequence is highly conserved across photosynthetic organisms, indicating its fundamental importance to the photosynthetic apparatus.

What are the different forms of recombinant N. debneyi Photosystem Q(B) protein available for research?

Researchers can utilize several forms of this protein based on their specific experimental requirements:

  • Full-length mature protein (amino acids 2-344)

  • Partial protein fragments for specific domain studies

  • Tagged versions with N-terminal modifications:

    • His-tagged (including 10xHis-tagged options)

    • Other tag types that may be determined during manufacturing

  • Proteins expressed in different systems:

    • E. coli expression systems

    • Mammalian cell expression systems

The choice between these forms depends on the specific research questions being addressed, with full-length proteins being ideal for structural and functional studies, while tagged versions facilitate purification and detection in complex experimental setups.

What is the optimal storage protocol for maintaining protein stability?

The optimal storage protocol depends on both the protein form and intended experimental timeline :

Protein FormRecommended StorageShelf LifeWorking Storage
Lyophilized-20°C/-80°C12 months4°C (≤1 week)
Liquid-20°C/-80°C6 months4°C (≤1 week)

For long-term storage, both forms should be kept at -20°C or preferably -80°C . It's crucial to avoid repeated freeze-thaw cycles as these significantly degrade protein quality and functional activity . For working aliquots that will be used within one week, storage at 4°C is recommended to minimize freeze-thaw damage. Proper aliquoting upon initial reconstitution is strongly recommended to prevent the need for multiple freeze-thaw cycles of the same sample.

How should the lyophilized protein be reconstituted for optimal activity?

The reconstitution process is critical for maintaining protein functionality and requires careful attention to several factors:

  • Brief centrifugation: Prior to opening, briefly centrifuge the vial to bring all contents to the bottom and prevent sample loss .

  • Reconstitution solution: Use deionized sterile water to reconstitute the protein to a concentration of 0.1-1.0 mg/mL .

  • Glycerol addition: Add glycerol to a final concentration of 5-50% to maintain stability during storage. A standard 50% final glycerol concentration is commonly recommended .

  • Buffer considerations: The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability .

  • Gentle mixing: Use gentle pipetting or slow inversion to mix the solution rather than vortexing, which can denature the protein.

Following reconstitution, aliquot the protein into appropriate volumes for experimental use to avoid repeated freeze-thaw cycles of stock solutions.

What analytical methods are most effective for assessing purity and functionality of the recombinant protein?

Several analytical methods are appropriate for characterizing the recombinant Photosystem Q(B) protein:

  • SDS-PAGE: The primary method mentioned in product specifications for assessing protein purity, with recombinant proteins typically showing >85-90% purity . This technique separates proteins based on molecular weight, allowing verification of the expected 32 kDa size.

  • Western Blotting: For His-tagged versions, anti-His antibodies can be used to confirm the presence of the tag and verify protein identity.

  • Circular Dichroism (CD): Useful for assessing secondary structure, particularly important for membrane proteins like Photosystem Q(B).

  • Electron Paramagnetic Resonance (EPR): Can be used to study the redox properties and electron transfer function of the protein.

  • Functional Assays: For Photosystem II proteins, oxygen evolution measurements using Clark-type electrodes can assess functional activity.

Each method provides different information about protein quality, and researchers should select methods appropriate to their specific experimental questions.

How can the recombinant Photosystem Q(B) protein be incorporated into artificial photosynthetic systems?

Incorporating the recombinant Photosystem Q(B) protein into artificial photosynthetic systems requires careful consideration of membrane mimetics and supporting components:

  • Liposome Incorporation: The transmembrane nature of the protein necessitates reconstitution into lipid bilayers that mimic the thylakoid membrane environment. This can be achieved using liposomes composed of phosphatidylcholine and phosphatidylglycerol.

  • Nanodiscs: Membrane scaffold protein (MSP) nanodiscs provide a more controlled environment for studying the protein's functional properties.

  • Supporting Components: The protein functions as part of a complex system and requires other Photosystem II components to exhibit full functionality. Consider co-reconstitution with:

    • Other PSII proteins

    • Appropriate cofactors (chlorophylls, carotenoids)

    • Manganese clusters for the oxygen-evolving complex

  • Electron Acceptors: Include appropriate plastoquinone analogues to enable electron transport at the QB site.

  • Monitoring Methods: Implement spectroscopic methods (fluorescence, absorption) to monitor electron transfer events and protein function within the artificial system.

This approach allows for studying the protein's role in electron transport chains under controlled conditions that can be precisely manipulated for experimental purposes.

What are the common challenges when working with recombinant photosynthetic proteins and how can they be addressed?

Several challenges arise when working with recombinant photosynthetic proteins like Photosystem Q(B):

  • Maintaining Membrane Protein Solubility:

    • Challenge: The hydrophobic nature of transmembrane domains makes handling difficult

    • Solution: Use appropriate detergents (n-dodecyl-β-D-maltoside or digitonin) during purification and reconstitution

  • Preserving Native Conformation:

    • Challenge: Expression in non-native systems can lead to improper folding

    • Solution: Optimize expression conditions (temperature, induction parameters) and consider using membrane-mimetic environments

  • Cofactor Association:

    • Challenge: The protein may lack essential cofactors when recombinantly expressed

    • Solution: Implement reconstitution protocols that include relevant cofactors

  • Functional Assessment:

    • Challenge: Confirming that the recombinant protein maintains native function

    • Solution: Develop appropriate functional assays specific to electron transfer capabilities

  • Aggregation Prevention:

    • Challenge: Protein aggregation during storage and handling

    • Solution: Maintain glycerol concentrations (5-50%) and avoid freeze-thaw cycles

Addressing these challenges requires careful optimization of each experimental step, from expression to storage and functional analysis.

How can site-directed mutagenesis be used to investigate structure-function relationships in the Photosystem Q(B) protein?

Site-directed mutagenesis offers powerful insights into the structure-function relationships of Photosystem Q(B) protein:

  • Target Selection: Based on the amino acid sequence (aa 2-344) , researchers can target specific residues for mutagenesis:

    • Quinone-binding pocket residues that interact with QB

    • Transmembrane helices that position the protein

    • Residues involved in interactions with other PSII components

    • Regions susceptible to photodamage

  • Mutation Design Strategy:

    • Conservative substitutions to study subtle functional effects

    • Non-conservative changes to disrupt specific interactions

    • Alanine-scanning mutagenesis to systematically evaluate residue importance

  • Expression System Considerations:

    • Express mutants in the same system as wild-type for valid comparisons

    • Use the E. coli expression system for higher throughput of mutant variants

  • Functional Characterization:

    • Compare electron transfer rates between wild-type and mutant proteins

    • Assess structural changes using spectroscopic methods

    • Evaluate protein stability under various conditions

  • Data Integration:

    • Map functional changes to the three-dimensional structure

    • Correlate mutations with changes in photosynthetic efficiency

This approach allows researchers to develop detailed mechanistic models of how specific amino acids contribute to the protein's critical role in photosynthesis.

How does the recombinant protein from E. coli expression systems compare with that from mammalian cell systems?

The expression system significantly impacts the properties of the recombinant Photosystem Q(B) protein:

CharacteristicE. coli Expression Mammalian Cell Expression
Protein YieldGenerally higherGenerally lower
Post-translational ModificationsLimitedMore extensive
Protein FoldingMay require refoldingOften better native folding
ScalabilityHighly scalableLess scalable
CostLower production costsHigher production costs
Purity>90% by SDS-PAGE >85% by SDS-PAGE
ApplicationsStructural studies, mutagenesisFunctional studies requiring PTMs

The choice between expression systems should be guided by the specific research requirements. E. coli-expressed protein is suitable for high-throughput structural studies and mutagenesis work, while mammalian cell-expressed protein may better preserve certain functional characteristics that depend on post-translational modifications. In both cases, the protein can be produced with high purity (>85-90%) as assessed by SDS-PAGE analysis.

What controls should be included when using the recombinant protein in experimental setups?

Proper experimental design requires appropriate controls when working with recombinant Photosystem Q(B) protein:

  • Negative Controls:

    • Buffer-only controls to account for buffer effects

    • Expression system host proteins without the recombinant gene

    • Heat-denatured protein to distinguish specific from non-specific effects

  • Positive Controls:

    • Commercial standards of known quality when available

    • Native thylakoid membrane preparations containing natural Photosystem II

    • Previously validated batches of the recombinant protein

  • Technical Controls:

    • Tag-only proteins to assess tag-mediated effects

    • Different protein concentrations to establish dose-dependency

    • Time-course measurements to capture dynamic processes

  • Sample Processing Controls:

    • Freshly thawed versus stored aliquots to assess stability

    • Samples with different glycerol concentrations to evaluate preservation effects

  • Environmental Controls:

    • Light/dark conditions to assess photosensitivity

    • Temperature variations to determine thermal stability

    • pH range tests to identify optimal conditions

Implementing these controls helps ensure experimental robustness and facilitates the interpretation of results by distinguishing specific protein effects from experimental artifacts.

What are the key considerations for researchers new to working with recombinant photosynthetic proteins?

Researchers new to working with recombinant Photosystem Q(B) protein should focus on several critical aspects:

  • Expression and Purification:

    • Choose between E. coli (higher yield, simpler) and mammalian systems (potentially better folding)

    • Consider the impact of tags on protein function, with His-tags being common and generally well-tolerated

  • Handling and Storage:

    • Properly aliquot reconstituted protein to minimize freeze-thaw cycles

    • Maintain appropriate storage temperatures (-20°C/-80°C for long-term)

    • Add glycerol (5-50%) to stabilize during storage

  • Experimental Design:

    • Include appropriate controls (as detailed in 4.2)

    • Consider the membrane protein nature in assay design

    • Validate functionality using multiple complementary methods

  • Data Interpretation:

    • Compare results with literature on native protein function

    • Account for differences between recombinant and native proteins

    • Consider the impact of expression system on protein properties

  • Interdisciplinary Approach:

    • Combine structural, biochemical, and functional analyses for comprehensive understanding

    • Collaborate with specialists in photosynthesis for result interpretation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.