Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein C, chloroplastic (CABC)

Shipped with Ice Packs
In Stock
Cat. No.
BT2472562
Source
in vitro E.coli expression system
Synonyms
CABC; Chlorophyll a-b binding protein C, chloroplastic; LHCII type I CAB-C; LHCP
Quick Inquiry

Description

General Information

  • Species: Nicotiana plumbaginifolia (Leadwort-leaved tobacco)

  • Synonyms: CABC; Chlorophyll a-b binding protein C, chloroplastic; LHCII type I CAB-C; LHCP

  • Source: E. coli

  • Tag: His

  • Protein Length: Full Length of Mature Protein (36-267 aa)

  • UniProt ID: P12469

  • Applications: SDS-PAGE

Structure

All ABC transport proteins share a structural organization consisting of four core domains . These domains consist of two trans-membrane (T) domains and two cytosolic (A) domains . The two T domains alternate between an inward and outward facing orientation, and the alternation is powered by the hydrolysis of adenosine triphosphate or ATP . ATP binds to the A subunits and it is then hydrolyzed to power the alternation, but the exact process by which this happens is not known .

Amino Acid Sequence

The amino acid sequence of Recombinant Full Length Nicotiana Plumbaginifolia Chlorophyll A-B Binding Protein C, Chloroplastic(Cabc) Protein is :

RKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK

Properties

PropertyDescription
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionIt is recommended that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. The default final concentration of glycerol is 50%. Customers could use it as a reference .
Gene NameCABC

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CABC; Chlorophyll a-b binding protein C, chloroplastic; LHCII type I CAB-C; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Nicotiana plumbaginifolia (Leadwort-leaved tobacco) (Tex-Mex tobacco)
Target Names
CABC
Target Protein Sequence
RKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.
P12469

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.