Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein E, chloroplastic (CABE)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Nicotiana plumbaginifolia Chlorophyll a-b binding protein E, chloroplastic (CABE) refers to a specific protein expressed in a recombinant form, originally derived from the plant species Nicotiana plumbaginifolia, also known as Leadwort-leaved tobacco or Tex-Mex tobacco . CABE is a Chlorophyll a-b binding protein E, located in the chloroplastic region of the plant cell . These proteins are vital for photosynthesis, specifically in the light-harvesting process.

Function and Significance

CABE is a light-harvesting chlorophyll a/b-binding (LHC) protein . LHC proteins are associated with the thylakoid membranes in chloroplasts and are essential for capturing light energy and transferring it to the photosynthetic reaction centers .

Recombinant Production and Applications

Recombinant CABE is produced using genetic engineering techniques, where the gene encoding CABE from Nicotiana plumbaginifolia is inserted into a host organism (e.g., Escherichia coli) for expression and subsequent purification of the protein . Recombinant proteins like CABE are useful in various biochemical and biophysical studies. These studies help elucidate the protein’s structure, function, and interactions with other molecules .

Research and Findings

Research AreaFindings
Aromatic HydroxylasesPgaE and CabE are members of the para-hydroxybenzoate hydroxylase (pHBH) fold family of aromatic hydroxylases .
Protein StructuresThe crystal structures of CabE were determined using X-ray crystallography .
Substrate ToleranceStructural analyses revealed local structural changes that may explain the observed expanded substrate tolerance exhibited by CABE variants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your own preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CABE; Chlorophyll a-b binding protein E, chloroplastic; LHCII type I CAB-E; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-266
Protein Length
Full Length of Mature Protein
Species
Nicotiana plumbaginifolia (Leadwort-leaved tobacco) (Tex-Mex tobacco)
Target Names
CABE
Target Protein Sequence
RKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQALVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Nicotiana plumbaginifolia Chlorophyll a-b binding protein E (CABE) and what is its function?

    Nicotiana plumbaginifolia Chlorophyll a-b binding protein E (CABE) is a nuclear-encoded photoregulated gene that produces a protein that binds chlorophyll molecules within the thylakoid membranes of chloroplasts. The protein functions as part of the light-harvesting complexes in photosystem II, playing a crucial role in capturing light energy and transferring it to reaction centers for photosynthesis. The Cab-E gene contains multiple regulatory elements that control its expression in response to light conditions, making it an important component of the plant's photosynthetic machinery and adaptation to changing light environments .

  • What regulatory elements have been identified in the CABE gene promoter?

    Research has identified several key regulatory elements in the CABE gene promoter that control its expression:

    • Two positive regulatory elements (PRE1 and PRE2) that confer maximum levels of photoregulated expression, containing multiple repeated elements related to the sequence ACCGGCCCACTT

    • A negative regulatory element (NRE) that is extremely rich in AT sequences, which reduces gene expression in light

    • A light regulatory element (LRE) within the promoter region extending from -396 to -186 bp that confers photoregulated expression

    • A crucial 132-bp element (from -368 to -234 bp) that, when deleted, reduces gene expression from high to undetectable levels

    • The TATA box-proximal sequences that play an important role in high-level expression

  • How does CABE expression respond to various environmental stresses?

    While the original Cab-E gene's specific stress responses aren't detailed in the provided research, studies on related CAB genes show differential expression patterns under various stresses. For instance, in tea plants, the expression of CsCP1 (a CAB protein) was inhibited in response to six different types of stress, while CsCP2 expression was slightly upregulated only after cold stress and ABA treatment. Other CAB family genes showed significant upregulation under various stress conditions. This suggests that different CAB family members, including CABE, likely have distinct roles in stress response pathways, with expression patterns that can be either downregulated or upregulated depending on the specific stress and the particular CAB gene involved .

  • How is the CABE gene structurally organized?

    The Cab-E gene from Nicotiana plumbaginifolia contains a well-characterized promoter region with multiple regulatory elements. The promoter includes two positive regulatory elements (PRE1 and PRE2) containing the sequence ACCGGCCCACTT, a negative regulatory element (NRE) rich in AT sequences, and a light regulatory element (LRE) in the region from -396 to -186 bp. Within this region, a critical 132-bp element (from -368 to -234 bp) is essential for expression. The gene also contains a TATA box that interacts with other regulatory elements to control expression levels. This structural organization allows for precise control of gene expression in response to light conditions, demonstrating the complex regulation of this important photosynthetic protein .

Advanced Research Questions

  • What methodologies are most effective for recombinant expression of CABE protein?

    For recombinant expression of CABE protein, several methodologies have proven effective:

    Expression System Selection:

    • E. coli-based expression: While efficient for producing the protein, the recombinant CABE precursor tends to accumulate in inclusion-like bodies, requiring solubilization in 6 M urea followed by dialysis into 20 mM Tris-HCl (pH 8.0) .

    • Agrobacterium tumefaciens-mediated transformation: More effective for studying in planta expression and regulation, as demonstrated in the original CAB-E characterization studies .

    Protein Recovery and Analysis:

    • For E. coli-expressed protein, gel filtration chromatography reveals that after refolding, recombinant CABE forms heterogeneous oligomeric complexes (60-300 kDa) rather than existing as 31 kDa monomers .

    • Circular dichroism analysis can confirm proper folding with characteristic alpha-helix and beta-sheet structures .

    Functional Verification:

    • Chloroplast import assays can verify functionality, as approximately half of properly refolded recombinant CABE is cleavable at the transit peptide-mature protein junction by chloroplast-processing enzymes .

    • Immunofluorescence microscopy can visualize envelope association, confirming proper targeting .

  • How do mutations in different regulatory elements of the CABE promoter affect its expression patterns?

    Research on the CABE promoter has revealed specific effects of mutations in different regulatory elements:

    Regulatory ElementLocationEffect of Deletion/Mutation
    PRE1 and PRE2Upstream sequencesSignificant reduction in maximum levels of photoregulated expression
    NRE (AT-rich)Upstream regionIncreased expression levels in light conditions due to removal of negative regulation
    LRE-396 to -186 bpLoss of photoregulated expression when fused to constitutive promoters
    132-bp element-368 to -234 bpComplete loss of expression (from high to undetectable levels)
    TATA box-proximal sequencesNear transcription startNon-replaceable by corresponding sequences from other promoters in full-length constructs

    These findings demonstrate the complex interplay between different regulatory elements in controlling CABE expression. The deletion analysis approach using chimeric gene constructs transformed into tobacco cells via Agrobacterium tumefaciens has been particularly effective in characterizing these elements and their contributions to photoregulated expression .

  • How can virus-induced gene silencing (VIGS) be optimized for studying CABE function?

    Virus-induced gene silencing (VIGS) can be optimized for studying CABE function through several key methodological considerations:

    Vector Selection and Design:

    • Tobacco rattle virus (TRV) vectors have proven effective for silencing plant genes, as demonstrated in studies of chlorophyll a/b binding proteins .

    • The target sequence should be carefully selected for specificity within the CABE gene to avoid off-target effects on other CAB family members.

    Inoculation and Expression Monitoring:

    • Optimal conditions include using resuspension buffer at pH 5.8 for virus preparation .

    • RNA-Seq and qRT-PCR monitoring can confirm silencing efficiency, which can reach 90% after 10 days of inoculation and maintain above 80% after 15 days .

    Phenotypic Analysis:

    • CAB gene silencing typically results in visible leaf bleaching phenotypes, serving as useful visual markers of successful silencing .

    • Comparative transcriptome analysis should be conducted, as silencing one CAB gene may trigger reduction in expression of multiple CAB family members .

    Physiological Measurements:

    • Photosynthetic parameters should be measured, as CAB silencing affects photosystem efficiency .

    • Plant growth parameters and stress response should be monitored, as CAB genes influence leaf development and stress tolerance .

  • What is the relationship between CABE protein structure and its chlorophyll-binding properties?

    The CABE protein's structure directly influences its chlorophyll-binding properties through several key features:

    Binding Domain Architecture:

    • CABE, like other CAB proteins, contains chlorophyll-binding domains composed of hydrophobic alpha-helical regions that span the thylakoid membrane .

    • Critical amino acid residues, particularly negatively charged residues like Asp (D) or Glu (E) in helix I, provide binding sites for the Mg atom in chlorophyll molecules .

    Coordination Chemistry:

    • For effective chlorophyll binding, negative charges from acidic amino acids must be neutralized by ionic bridges to Arg (R) side chains .

    • This structural arrangement suggests that CAB protein dimers could potentially bind two chlorophyll a molecules .

    Functional Domains:

    • Recombinant CAB proteins can contain multiple regulatory domains, such as SH3 domains (Src Homology-3) or Rho domains (from Rho subfamily of Ras-like small GTPases) .

    • These domains, along with phosphorylation sites (like protein kinase C phosphorylation sites) and phosphatase domains, make CAB proteins targets for physiological regulation in photosystem II .

    Pigment Selectivity:

    • Unlike the major light-harvesting complex LHCII, which shows absolute selectivity for certain chromophores, CP29 (a minor CAB family member) can accommodate different chromophores depending on availability, suggesting similar flexibility might exist in CABE .

  • How does the CABE protein interact with other components of the photosynthetic machinery?

    The CABE protein engages in multiple interactions within the photosynthetic machinery:

    Integration into Photosystem II:

    • CABE functions as part of the light-harvesting antenna complex of photosystem II (PSII), where it coordinates with other proteins to capture and funnel light energy to reaction centers .

    • The protein's position within the external or internal antenna system defines its specific role in energy capture and transfer .

    Pigment-Protein Interactions:

    • Beyond chlorophyll binding, CABE likely interacts with carotenoids such as lutein, which plays a structural role in CAB protein complexes as suggested by crystallographic data for homologous proteins .

    • These pigment-protein interactions are critical for both structural stability and proper energy transfer functioning .

    Regulatory Protein Interactions:

    • The presence of domains like SH3 and phosphorylation sites suggests CABE interacts with regulatory proteins that modulate its activity through post-translational modifications .

    • Phosphorylation/dephosphorylation events likely regulate CABE in response to changing environmental conditions, particularly light intensity fluctuations .

    Stress Response Coordination:

    • During stress conditions, CABE likely participates in dynamic reorganization of the photosynthetic apparatus, potentially through altered protein-protein interactions that help protect the photosystem from damage .

  • What phylogenetic relationships exist between CABE and other CAB family proteins across plant species?

    Phylogenetic analysis reveals complex evolutionary relationships between CABE and other CAB family proteins:

    Family Size and Diversity:

    • The CAB gene family is typically large in plants, with 25 homologous genes identified in tea plants and varying numbers in other species .

    • These genes form distinct subfamilies that correspond to different functional roles within the photosynthetic apparatus .

    Conservation Patterns:

    • The chloroplast transit peptide sequence shows less conservation than the mature protein sequence, reflecting the different evolutionary pressures on targeting versus functional domains .

    • Certain motifs related to chlorophyll binding show high conservation across species, indicating their fundamental importance to protein function .

    Evolutionary Origins:

    • CAB proteins likely share a common ancestral origin but have diversified to fulfill specialized roles in different parts of the photosystem .

    • In Nicotiana species, complete chloroplast genome analysis places N. plumbaginifolia (the source of CABE) in close relationship with N. suaveolens and N. amplexicaulis .

    Subfamilies and Specialization:

    • CAB proteins are categorized into subfamilies like Lhca (associated with PSI) and Lhcb (associated with PSII), with CABE belonging to the Lhcb subfamily .

    • Within these subfamilies, further specialization has occurred, leading to proteins like the minor antenna protein CP29 (Lhcb4) that show different pigment-binding properties compared to major LHCII proteins .

  • How can CRISPR-Cas9 genome editing be used to study CABE function?

    CRISPR-Cas9 genome editing offers powerful approaches for studying CABE function:

    Targeted Mutagenesis Strategies:

    • Precise editing of specific regulatory elements within the CABE promoter (PRE1, PRE2, NRE, LRE) can reveal their individual contributions to expression regulation without removing the entire element .

    • Introduction of point mutations in chlorophyll-binding domains can elucidate structure-function relationships of specific amino acid residues .

    Experimental Design Considerations:

    • For Nicotiana plumbaginifolia, Agrobacterium-mediated delivery of CRISPR-Cas9 components is most effective, utilizing promoters that work well in this species .

    • When designing guide RNAs, researchers should consider the high AT content in certain regions of the CABE promoter, particularly the NRE, which may affect guide RNA efficiency .

    Phenotypic Analysis Approaches:

    • Edited plants should be analyzed for altered photoresponses, including changes in chlorophyll fluorescence parameters, photosynthetic efficiency, and response to different light intensities .

    • Analysis of protein-pigment complexes through techniques like native gel electrophoresis can reveal how specific mutations affect assembly and stability .

    Integration with Other Techniques:

    • Combining CRISPR editing with techniques like chromatin immunoprecipitation (ChIP) can identify transcription factors that interact with specific regulatory elements .

    • RNA-seq analysis of edited plants under various light conditions and stresses can reveal broader impacts of CABE modifications on the transcriptome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.