Recombinant Nicotiana sylvestris Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please specify this in your order; we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nsy:3735070

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the biological significance of Nicotiana sylvestris in plant molecular biology?

Nicotiana sylvestris, commonly referred to as woodland tobacco, is a diploid model organism widely used in plant biology. It belongs to the Solanaceae family and is native to South America, particularly the Andes region. Its significance lies in its utility for studying genetic, biochemical, and physiological processes due to its relatively simple genome and its role as a progenitor of Nicotiana tabacum, the cultivated tobacco species . In molecular biology, it serves as a model for understanding secondary metabolite biosynthesis pathways, such as terpenoid production, and for exploring photosynthetic protein complexes like cytochrome b6f .

How is recombinant apocytochrome f (petA) expressed in Nicotiana sylvestris?

Recombinant apocytochrome f (petA) can be expressed in Nicotiana sylvestris through chloroplast transformation techniques. The petA gene, encoding the precursor protein of cytochrome f, is introduced into the chloroplast genome using homologous recombination. This process involves designing transformation vectors containing regulatory elements like promoters and ribosome-binding sites specific to chloroplast expression systems . Experimental studies often utilize truncated or modified versions of petA to investigate protein maturation, heme attachment, and membrane integration .

The expression process requires careful optimization of codon usage to match the chloroplast translation machinery. Additionally, post-translational modifications such as cleavage of signal peptides by thylakoid processing peptidases are crucial for proper folding and functionality of apocytochrome f .

What are the key structural features of apocytochrome f that influence its function?

Apocytochrome f is a component of the cytochrome b6f complex involved in photosynthetic electron transport. Its structure includes several distinctive features critical for its function:

  • Heme-binding domain: The c-heme group is covalently attached to specific cysteine residues in apocytochrome f. This attachment is essential for electron transfer activity .

  • Signal peptide: The precursor form contains an N-terminal signal peptide that directs its translocation into the thylakoid membrane. Cleavage of this peptide exposes the alpha-amino group of Tyr1, which serves as an axial ligand for heme binding .

  • Membrane anchor: The C-terminal region often contains hydrophobic sequences that facilitate membrane integration. Truncated versions lacking this region can still assemble into functional complexes under certain conditions .

Recent crystallographic studies have highlighted conserved residues that contribute to the stability and interaction of apocytochrome f within the cytochrome b6f complex .

What experimental approaches are used to study the maturation of apocytochrome f?

The maturation of apocytochrome f involves multiple steps, including signal peptide cleavage, heme attachment, and folding into its functional conformation. Researchers employ various experimental techniques to study these processes:

  • Site-directed mutagenesis: This method allows for targeted modifications of amino acid residues involved in heme binding or signal peptide cleavage. For example, substituting cysteine residues responsible for covalent heme ligation can reveal their role in protein processing .

  • Chloroplast transformation: Transforming Nicotiana sylvestris chloroplasts with wild-type or mutant petA genes enables in vivo analysis of protein synthesis, processing rates, and assembly into cytochrome b6f complexes .

  • Proteolytic assays: These assays help identify cleavage sites for thylakoid processing peptidases and assess the impact of sequence alterations on processing efficiency .

  • Spectroscopic techniques: UV-visible spectroscopy and electron paramagnetic resonance (EPR) are used to monitor heme binding and redox properties of apocytochrome f.

These approaches provide insights into the interplay between protein structure, enzymatic processing, and functional assembly.

How does recombinant expression affect the folding and stability of apocytochrome f?

Recombinant expression systems often pose challenges related to protein folding and stability due to differences between native and heterologous environments. In Nicotiana sylvestris, factors influencing the folding and stability of recombinant apocytochrome f include:

  • Chaperone interactions: Molecular chaperones within chloroplasts assist in folding newly synthesized proteins into their native conformations.

  • Heme availability: Proper folding depends on timely incorporation of the c-heme group. Heme deficiency or mutations disrupting heme ligation can lead to misfolded or unstable proteins .

  • Membrane integration: The presence or absence of C-terminal membrane anchors affects how apocytochrome f interacts with thylakoid membranes and assembles into cytochrome b6f complexes .

Studies have shown that misfolded forms are rapidly degraded by proteolytic systems associated with thylakoid membranes . Optimizing expression conditions, such as temperature and co-expression of accessory factors, can enhance stability.

What are common challenges in analyzing recombinant apocytochrome f expression data?

Researchers studying recombinant apocytochrome f often encounter challenges related to data interpretation:

  • Heterogeneous expression levels: Variability in transcriptional or translational efficiency can lead to inconsistent protein yields.

  • Post-translational modifications: Differences in signal peptide cleavage or heme attachment efficiency may complicate comparisons between wild-type and mutant forms.

  • Protein degradation: Proteolytic degradation of misfolded proteins can obscure experimental results unless inhibitors or stabilizing agents are used.

  • Artifact formation: Overexpression may result in aggregation or non-specific interactions that do not occur under physiological conditions.

Addressing these challenges requires rigorous controls, such as including untransformed plants or using alternative expression systems for validation.

How do mutations in petA affect photosynthetic efficiency?

Mutations in petA can significantly impact photosynthetic efficiency by altering the functionality of cytochrome b6f complexes:

  • Heme-binding site mutations: Substitutions at cysteine residues responsible for heme ligation disrupt electron transfer within cytochrome b6f complexes .

  • Signal peptide alterations: Modifications to cleavage sites may delay precursor processing or impair proper folding, reducing complex assembly efficiency .

  • Membrane anchor deletions: Truncated forms lacking membrane anchors may assemble less efficiently but can still retain partial functionality under certain conditions .

Phenotypic analyses using chlorophyll fluorescence measurements or oxygen evolution assays help quantify these effects on photosynthetic performance.

What insights have structural studies provided about apocytochrome f?

Structural studies using X-ray crystallography and NMR spectroscopy have elucidated key aspects of apocytochrome f:

These findings provide a framework for designing experiments aimed at probing structure-function relationships.

What are future directions for research on recombinant apocytochrome f?

Future research on recombinant apocytochrome f may focus on several areas:

  • Engineering improved variants: Introducing mutations that enhance stability or catalytic activity could expand its applications in synthetic biology.

  • Exploring alternative hosts: Using other plant species or microbial systems might overcome limitations associated with Nicotiana sylvestris.

  • Integrating omics approaches: Combining transcriptomics, proteomics, and metabolomics could reveal new regulatory networks influencing petA expression.

  • Investigating environmental effects: Studying how abiotic factors like light intensity or temperature affect recombinant protein behavior could inform agricultural applications.

These directions aim to deepen our understanding while broadening practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.