Recombinant Nicotiana sylvestris Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nicotiana sylvestris Chloroplast Envelope Membrane Protein (cemA)

Recombinant Nicotiana sylvestris Chloroplast Envelope Membrane Protein (cemA) is a protein expressed in E. coli and derived from the chloroplast envelope membrane of the Nicotiana sylvestris plant (wood tobacco) . Chloroplasts rely on intricate biochemical machinery within their envelope membranes for development and functional integration within plant cells . The cemA protein is a component of this machinery. Proteomic analysis has identified numerous proteins in chloroplast envelope membranes, highlighting their roles in various functions, such as metabolite transport, protein import, and lipid metabolism .

Basic Information

CategoryDescription
Product NameRecombinant Nicotiana sylvestris Chloroplast envelope membrane protein (cemA)
SourceNicotiana sylvestris (Wood tobacco)
Expression SystemIn vitro E. coli expression system
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein, specifically the region spanning amino acids 1-229
Uniprot No.Q3C1I9
SequenceMAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKFIELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIILSGYSILGNEKLVILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND

Function and Localization

cemA is located in the chloroplast envelope membrane . Proteins found in the chloroplast envelope are involved in ion and metabolite transport, protein import machinery, and chloroplast lipid metabolism .

Expression and Transformation

Nicotiana sylvestris, along with Nicotiana benthamiana, can be transiently transformed to express recombinant proteins . Transient expression of proteins such as GFP (Green Fluorescent Protein) has been observed in both the cytoplasm and apoplast of N. sylvestris cells, with maximum expression levels around ten days post-transformation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKF IELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIIL SGYSILGNEKLVILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: nsy:3735123

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein A (cemA) and what is its role in Nicotiana sylvestris?

The chloroplast envelope membrane protein A (cemA) is an essential protein encoded by the chloroplast genome in Nicotiana species. In Nicotiana sylvestris, cemA is involved in chloroplast membrane structural integrity and function. The protein participates in CO₂ uptake mechanisms and may contribute to environmental stress responses. While specific functions can vary between species, comparative genomic analyses of Nicotiana species have shown that cemA is relatively conserved within the genus, suggesting its fundamental importance in chloroplast function .

How is cemA structured and organized within the chloroplast genome of Nicotiana sylvestris?

The cemA gene is encoded within the chloroplast genome of Nicotiana sylvestris, specifically located in one of the large single-copy (LSC) regions. Analysis of chloroplast genomes in related Nicotiana species reveals that cemA is positioned in a relatively conserved region. When studying chloroplast genome organization, researchers typically employ multiple sequence alignment techniques such as those using MAFFT and manual adjustments with BioEdit software to compare gene positioning and structure between species . The gene structure can be visualized after complete chloroplast genome assembly, which provides insights into evolutionary relationships between different Nicotiana species.

How does cemA in Nicotiana sylvestris compare with homologous proteins in other Nicotiana species?

Comparative analysis of cemA across Nicotiana species shows varying degrees of sequence conservation. When analyzed alongside other species like N. tabacum, N. tomentosiformis, and N. undulata, the cemA gene demonstrates characteristic patterns of sequence divergence. Researchers typically employ Kimura's two-parameter (K2P) model to calculate pairwise sequence divergences between species .

Sequence variability can be assessed through sliding window analysis using software like DnaSP, with window lengths of approximately 600 bp and step sizes of 200 bp. This approach reveals regions of higher conservation versus those with greater variability, which may correlate with functional domains of the protein . Phylogenetic analyses incorporating cemA sequences have contributed to our understanding of evolutionary relationships within the Nicotiana genus.

What are the most effective methods for isolating and purifying chloroplast envelope proteins from Nicotiana sylvestris?

Isolating chloroplast envelope proteins from Nicotiana sylvestris requires a carefully designed fractionation approach. An effective methodology involves:

  • Differential centrifugation to isolate intact chloroplasts

  • Osmotic shock to release envelope membranes

  • Sucrose gradient centrifugation to separate envelope fractions

For spatial proteomics and envelope membrane protein profiling, researchers should compare protein distribution across differentially enriched subfractions. This involves isolating both total intact chloroplasts and enriched envelope fractions, followed by MS-based protein identification in both preparations .

Envelope-located proteins should be present in both fractions but enriched in the envelope preparation. By calculating enrichment factors (comparing protein abundances between total chloroplast lysate and enriched envelopes), researchers can confidently identify true envelope membrane proteins. Non-envelope proteins will show depletion in the envelope fraction, providing an internal control for the purification efficiency .

What expression systems are most suitable for recombinant production of Nicotiana sylvestris cemA?

For recombinant production of Nicotiana sylvestris cemA, transient expression systems in Nicotiana species offer several advantages. Research demonstrates successful transient expression of recombinant proteins in both N. benthamiana and N. sylvestris . The expression can be targeted to different cellular compartments:

  • Cytoplasmic expression: Direct expression in the cell cytoplasm

  • Apoplastic expression: Expression with secretion to the apoplast

When designing expression constructs, researchers should consider adding epitope tags (such as OLLAS) to facilitate immunodetection of the recombinant protein . For cemA specifically, maintaining proper membrane integration may require specialized construct design with appropriate targeting sequences.

Confirmation of expression can be achieved through immunodetection techniques. For recombinant proteins expressed in Nicotiana systems, molecular weights can be verified by comparing observed band sizes (around 75 kDa for larger fusion proteins) with theoretical predictions based on amino acid sequence .

How can I optimize transient expression of recombinant cemA in Nicotiana systems?

Optimizing transient expression of recombinant cemA in Nicotiana systems requires attention to several key variables:

  • Vector selection: Choose vectors with strong promoters appropriate for chloroplast proteins

  • Codon optimization: Adapt the coding sequence to match Nicotiana codon usage preferences

  • Targeting signals: Include appropriate chloroplast/envelope targeting sequences

  • Transformation method: Agrobacterium-mediated infiltration typically yields highest efficiency

  • Expression timeframe: Monitor expression at multiple timepoints (3-7 days post-infiltration)

Temperature and lighting conditions significantly impact expression levels. For Nicotiana species, environmental factors such as mean temperature of warmest quarter (bio10), annual precipitation (bio12), solar radiation (particularly in September, Srad9), and soil properties like clay content can influence plant growth and protein expression efficiency .

Additionally, when designing constructs, researchers can include features like GFP fusion tags to visually monitor expression and localization patterns . This allows real-time assessment of expression efficiency before proceeding to protein purification steps.

What analytical techniques are most appropriate for characterizing recombinant cemA protein structure and function?

For comprehensive characterization of recombinant cemA protein structure and function, researchers should employ multiple complementary analytical approaches:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy for secondary structure assessment

    • Mass spectrometry for molecular weight confirmation and post-translational modifications

    • Protein modeling to predict three-dimensional structure and identify exposed epitopes

  • Functional Analysis:

    • Membrane incorporation assays

    • CO₂ uptake measurements

    • Interaction studies with other chloroplast proteins

  • Localization Confirmation:

    • Confocal microscopy with fluorescent protein fusions

    • Immunogold electron microscopy

    • Subcellular fractionation with immunodetection

Protein modeling is particularly valuable, as it can reveal whether key epitopes and functional domains are exposed on the protein surface, which may influence both function and immunogenicity if the protein is being developed as part of a recombinant vaccine or research tool .

How should researchers interpret variability in cemA expression levels between experiments?

When interpreting variability in cemA expression levels between experiments, researchers should systematically evaluate several potential sources of variation:

  • Biological Factors:

    • Plant age and developmental stage

    • Environmental growing conditions (temperature, light, humidity)

    • Genetic background of Nicotiana plants used

  • Methodological Factors:

    • Transformation efficiency

    • Vector design and promoter strength

    • Harvesting timepoint post-transformation

    • Protein extraction and detection methods

The influence of environmental factors cannot be overstated. Research on Nicotiana species demonstrates that variables such as mean temperature of warmest quarter (bio10), annual precipitation (bio12), solar radiation in September (Srad9), and soil clay content (CLAY) significantly affect plant physiology . These factors can directly impact protein expression systems and should be carefully controlled or at least documented to account for inter-experimental variation.

Statistical analysis incorporating these variables can help distinguish random variation from systematic effects. When comparing expression levels across experiments, normalized values (e.g., relative to a constitutively expressed control protein) provide more reliable comparisons than absolute values.

What bioinformatic approaches are recommended for analyzing cemA sequence conservation across Nicotiana species?

For analyzing cemA sequence conservation across Nicotiana species, researchers should implement a multi-layered bioinformatic approach:

  • Multiple Sequence Alignment:

    • Use MAFFT for initial alignment

    • Apply manual adjustments with BioEdit for refinement

    • Focus on both nucleotide and translated amino acid sequences

  • Variability Analysis:

    • Conduct sliding window analysis using DnaSP software

    • Set window length to 600 bp with 200 bp step size

    • Calculate nucleotide diversity (Pi) across different genomic regions

  • Evolutionary Distance Calculation:

    • Apply Kimura's two-parameter (K2P) model for pairwise sequence divergence

    • Compare rates of synonymous vs. non-synonymous substitutions

  • Phylogenetic Analysis:

    • Construct trees using multiple methods (Maximum Likelihood, Maximum Parsimony, Bayesian Inference)

    • Include appropriate outgroups (e.g., other Solanaceae species)

    • Evaluate node support through bootstrap analysis

When analyzing chloroplast genes like cemA, it's important to consider the genomic context, including the organization of surrounding genes and the position relative to inverted repeat (IR), large single-copy (LSC), and small single-copy (SSC) regions of the chloroplast genome .

How can cemA be utilized in studies of chloroplast evolution within the Nicotiana genus?

The cemA gene offers valuable insights for studying chloroplast evolution within the Nicotiana genus. Researchers can leverage this gene through several approaches:

  • Comparative Genomics:

    • Align cemA sequences across multiple Nicotiana species (N. sylvestris, N. tabacum, N. tomentosiformis, N. undulata)

    • Calculate evolutionary distances using appropriate models like Kimura's two-parameter method

    • Identify selection patterns acting on different regions of the gene

  • Phylogenetic Analysis:

    • Include cemA in multi-gene chloroplast phylogenies

    • Compare cemA-based trees with those derived from other chloroplast genes

    • Evaluate topological incongruence as evidence of reticulate evolution or introgression

  • Hybridization Studies:

    • Examine cemA in known amphiploid species like N. tabacum

    • Trace parental origins in polyploid species

    • Study chromosome inheritance patterns in experimental hybrid crosses

Research on multiple allopolyploid Nicotiana species has demonstrated that hybridization events leave detectable signatures in the chloroplast genome. For instance, studies of experimental hybrids combining genomes from diverse species (N. bigelovii, N. debneyi, and N. tabacum) have shown the selective retention of certain chromosomes during subsequent generations . Similar patterns may be observable in cemA evolution, potentially providing insights into the complex evolutionary history of the genus.

What role might cemA play in chloroplast stress responses, and how can this be experimentally investigated?

The chloroplast envelope membrane protein A (cemA) likely participates in stress response mechanisms, particularly those involving temperature fluctuations. To investigate this function experimentally:

  • Differential Expression Analysis:

    • Compare cemA expression levels under normal and stress conditions

    • Use quantitative PCR and/or proteomics approaches

    • Analyze temporal expression patterns during stress onset and recovery

  • Comparative Proteomics:

    • Employ spatial proteomics to analyze envelope protein profiles during stress

    • Fractionate chloroplasts and compare protein distribution across subfractions

    • Calculate enrichment factors for cemA and related proteins under different conditions

  • Functional Knockdown/Knockout Studies:

    • Develop CRISPR/Cas9 or RNAi constructs targeting cemA

    • Evaluate phenotypic changes in modified plants under stress conditions

    • Assess changes in chloroplast function and CO₂ uptake

  • Protein Interaction Networks:

    • Identify cemA interaction partners under normal and stress conditions

    • Use techniques like co-immunoprecipitation or yeast two-hybrid screening

    • Map changes in the interactome during stress response

Research on chloroplast envelope proteins has demonstrated their critical role in cold acclimation and frost tolerance in plants like Arabidopsis thaliana . Similar approaches could be applied to investigate cemA's role in Nicotiana sylvestris stress responses, potentially revealing novel mechanisms of environmental adaptation.

How can protoplast technology be leveraged for studying cemA function in Nicotiana sylvestris?

Protoplast technology offers powerful approaches for studying cemA function in Nicotiana sylvestris:

  • Isolation and Transformation:

    • Isolate protoplasts using commercial fungal cellulases, hemicellulases, and pectinases

    • Transform protoplasts with constructs expressing native or modified cemA

    • Monitor transformation efficiency and expression using fluorescent markers

  • Subcellular Localization:

    • Use fluorescently-tagged cemA to track protein localization within protoplasts

    • Co-localize with known chloroplast envelope markers

    • Analyze dynamic changes in localization under different conditions

  • Single-Cell Functional Studies:

    • Measure physiological parameters in individual transformed protoplasts

    • Compare cemA-overexpressing, knockdown, and wild-type protoplasts

    • Assess membrane integrity and function in response to stress treatments

  • Protoplast Fusion Applications:

    • Create hybrid cells by fusing protoplasts from different Nicotiana species

    • Study cemA behavior and function in hybrid cellular environments

    • Investigate organelle transfer and interaction with nuclear-encoded factors

The pioneering work of Takebe and colleagues demonstrated that tobacco protoplasts can undergo mitotic division and regenerate into whole plants . This regeneration capacity makes protoplast-based approaches particularly valuable for studying cemA function, as researchers can create modified plants from single cells with altered cemA expression or structure.

What are common challenges in recombinant cemA expression and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant cemA, each requiring specific troubleshooting strategies:

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Optimize codon usage for Nicotiana, use strong promoters, and consider fusion tags that enhance stability

    • Alternative approach: Test expression in different cellular compartments (cytoplasm vs. apoplast)

  • Protein Misfolding:

    • Challenge: Improper folding leading to aggregation or degradation

    • Solution: Include molecular chaperones in expression constructs

    • Alternative approach: Modify growth conditions (temperature, light cycles) to promote proper folding

  • Difficult Immunodetection:

    • Challenge: Poor antibody recognition of native cemA

    • Solution: Include epitope tags (like OLLAS) in recombinant constructs

    • Alternative approach: Use mass spectrometry for label-free detection and quantification

  • Variable Expression Between Plants:

    • Challenge: Inconsistent expression levels between experiments

    • Solution: Standardize environmental conditions based on known factors affecting Nicotiana growth (temperature, precipitation, solar radiation, soil composition)

    • Alternative approach: Pool material from multiple plants to normalize variation

Including appropriate controls at each experimental stage is crucial for troubleshooting. For instance, expressing a well-characterized protein (like GFP) alongside cemA provides a reference point for assessing transformation efficiency and expression levels .

What considerations are important when designing primers for cemA amplification and cloning?

Designing effective primers for cemA amplification and cloning requires attention to several key considerations:

  • Sequence Specificity:

    • Analyze sequence conservation across Nicotiana species

    • Target highly conserved regions for universal primers

    • Design species-specific primers for regions with higher variability

    • Verify primer specificity using in silico PCR against available genomic databases

  • Structural Features:

    • Optimal primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs

    • Avoid secondary structures and primer-dimer formation

  • Cloning Considerations:

    • Include appropriate restriction sites with 3-6 extra nucleotides at the 5' end

    • Maintain the reading frame for expression constructs

    • Consider adding tags or fusion partners as needed for detection or purification

  • Application-Specific Design:

    • For quantitative PCR: design amplicons of 80-150 bp

    • For full-length cloning: consider using high-fidelity polymerases

    • For site-directed mutagenesis: incorporate desired mutations in the primer sequence

When working with chloroplast genes like cemA, researchers should carefully consider the genomic context, including gene arrangement and the presence of inverted repeats, which can complicate amplification strategies . Testing primers on multiple Nicotiana species can provide valuable insights into their broader applicability across the genus.

How can researchers ensure the recombinant cemA maintains native structure and function?

Ensuring recombinant cemA maintains its native structure and function requires a multi-faceted validation approach:

  • Structural Verification:

    • Compare predicted secondary structure with native protein

    • Use protein modeling to confirm that key epitopes remain exposed on the surface

    • Employ circular dichroism or other spectroscopic methods to assess secondary structure elements

  • Localization Confirmation:

    • Verify proper targeting to chloroplast envelope membranes

    • Use subcellular fractionation to confirm enrichment in envelope preparations

    • Employ fluorescent protein fusions to visualize localization patterns in vivo

  • Functional Assays:

    • Develop and apply specific assays for cemA function (CO₂ uptake, membrane integrity)

    • Compare activity levels between recombinant and native protein

    • Assess complementation ability in cemA-deficient systems

  • Interaction Profiling:

    • Identify known interaction partners of native cemA

    • Confirm that recombinant protein maintains these interactions

    • Use techniques like co-immunoprecipitation or proximity labeling

When expressing membrane proteins like cemA, maintaining proper membrane integration is crucial. Researchers should consider the impact of any tags or fusion partners on membrane insertion and topology. If possible, position tags on predicted cytoplasmic or stromal domains rather than transmembrane regions or functional domains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.