Recombinant Nicotiana sylvestris Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nicotiana sylvestris Cytochrome b6-f Complex Subunit 4 (petD)

The cytochrome b6-f complex is an essential enzyme found in the thylakoid membranes of chloroplasts in plants, green algae, and cyanobacteria . It facilitates the transfer of electrons from plastoquinol to plastocyanin during photosynthesis . Concurrently, it pumps protons into the thylakoid space, creating an electrochemical gradient that is then used to synthesize ATP from ADP .

Recombinant Nicotiana sylvestris Cytochrome b6-f complex subunit 4 (petD) refers to the subunit 4 of the cytochrome b6-f complex derived from Nicotiana sylvestris (a species of tobacco plant) that has been produced using recombinant DNA technology. Recombinant proteins are produced by introducing the gene encoding the protein of interest into a host organism (e.g., E. coli), which then expresses the protein.

petD Subunit

PetD is a subunit of the cytochrome b6-f complex . The petD protein is essential for the assembly and stability of the cytochrome b6-f complex .

Recombinant Production

Recombinant petD proteins, such as the Recombinant Full Length Nicotiana tabacum Cytochrome b6-f complex subunit 4(petD) Protein, are often produced in E. coli with an N-terminal His tag for purification purposes .

Applications in Research

Recombinant petD has several applications in plant biology research:

  • ** изучение структуры и функции:** Recombinant petD can be used to study the structure and function of the cytochrome b6-f complex .

  • Antibody Production: Recombinant petD can be used to generate antibodies against the petD protein, useful for detecting and quantifying the protein in plant tissues .

  • Assembly Studies: Recombinant petD is useful to study the assembly of the cytochrome b6-f complex .

Nicotiana Species and CRR4 Orthologs

Nicotiana sylvestris is utilized in studies of CRR4 orthologs, which are crucial in RNA editing related to chloroplast function . NsylCRR4 and NtomCRR4 (from N. tomentosiformis) are orthologs of Arabidopsis CRR4 and act as trans-factors in ndhD-1 RNA editing in Nicotiana species .

Dark Stress Response

In Nicotiana benthamiana, the response to prolonged darkness involves changes in proteomes and metabolomes, with the upregulation of autophagy-related gene (ATG) proteins . Proteins such as heat-shock protein (HSP70), SnRK1-interacting protein 1, 2A phosphatase-associated protein of 46 kDa (Tap46), and glutamate dehydrogenase (GDH) play key roles in the plant's response to dark stress .

Data Table: Cytochrome b6-f Complex Information

PropertyDescription
Enzyme Commission number7.1.1.6
Alternative namesPlastoquinol/plastocyanin reductase, plastoquinol/plastocyanin oxidoreductase
FunctionCatalyzes electron transfer from plastoquinol to plastocyanin
LocationThylakoid membrane in chloroplasts of plants, cyanobacteria, and green algae
Role in photosynthesisMediates electron and energy transfer between Photosystem II and Photosystem I; creates a proton gradient for ATP synthesis
petDSubunit 4 of the cytochrome b6-f complex, essential for complex assembly
Recombinant petD applicationsStudying structure and function, antibody production, assembly studies
Nicotiana CRR4 orthologsNsylCRR4 and NtomCRR4 are orthologs of Arabidopsis CRR4, functioning as trans-factors in ndhD-1 RNA editing
Dark stress responseUpregulation of ATG proteins; key roles for HSP70, SnRK1-interacting protein 1, Tap46, and GDH in Nicotiana benthamiana

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nsy:3735072

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD subunit play?

The cytochrome b6-f complex is a dimeric multi-subunit protein complex that functions as an electron transfer intermediate between photosystem II and photosystem I in the electron transport chain. Each monomer consists of a core formed by chloroplast-encoded proteins, including petD (subunit IV) . The petD subunit is plastome-encoded and essential for the complex's structure and function in the Q-cycle, potentially participating in the electron transfer pathway via the low-potential and high-potential hemes bound to cytochrome b6 .

What is the composition of the cytochrome b6-f complex in Nicotiana species?

The cytochrome b6-f complex in Nicotiana species consists of four large subunits and four small subunits. The large subunits include the plastid-encoded proteins cytochrome f (PetA), cytochrome b6 (PetB), and subunit IV (PetD), and the nucleus-encoded Rieske iron-sulfur protein (PETC) . The small peripheral subunits include the plastid-encoded proteins PetG, PetL, and PetN, as well as the nucleus-encoded PETM . These small subunits form single transmembrane helices and contribute to complex stabilization and/or regulation of complex activity .

How is the petD gene organized in the Nicotiana sylvestris plastid genome?

The petD gene is located in the plastid genome of Nicotiana sylvestris and is part of the large single-copy (LSC) region. It encodes subunit IV of the cytochrome b6-f complex. Based on plastid genomics studies, the structural organization of the plastid genome in Nicotiana species has been well characterized, with the gene content and order being highly conserved . The expansion and contraction of inverted repeats (IR) and their border positions have been compared across different Nicotiana species to understand genome evolution .

What are the recommended protocols for isolating the cytochrome b6-f complex from Nicotiana sylvestris?

For isolating the cytochrome b6-f complex from Nicotiana sylvestris, researchers should begin with young expanding leaves where de novo biogenesis of the complex is most active . The isolation procedure typically involves:

  • Tissue homogenization in an appropriate buffer containing protease inhibitors

  • Differential centrifugation to isolate thylakoid membranes

  • Solubilization of membrane proteins using mild detergents (such as n-dodecyl-β-D-maltoside)

  • Separation by sucrose gradient ultracentrifugation or column chromatography

  • Confirmation of complex integrity using blue-native polyacrylamide gel electrophoresis (BN-PAGE)

For recombinant production, researchers must consider the fact that some subunits are plastid-encoded while others are nucleus-encoded, requiring specialized expression systems.

How can researchers effectively analyze the assembly of the cytochrome b6-f complex?

Analysis of cytochrome b6-f complex assembly can be performed using several complementary approaches:

  • Blue-native polyacrylamide gel electrophoresis (BN-PAGE) to separate intact protein complexes and detect assembly intermediates

  • Co-immunoprecipitation assays to identify protein-protein interactions between subunits or with assembly factors

  • Bimolecular fluorescence complementation (BiFC) to visualize protein interactions in vivo

  • Pulse-chase experiments to track the temporal assembly of the complex

  • RNA interference (RNAi) or CRISPR/Cas9 approaches targeting specific subunits to analyze their role in complex assembly

These techniques have been successfully employed to demonstrate interactions between assembly factors like DEIP1 and the cytochrome b6-f subunits PetA and PetB in Arabidopsis .

What methods are recommended for studying RNA editing of petD transcripts in Nicotiana species?

To study RNA editing of petD transcripts in Nicotiana species, researchers should consider the following methodological approach:

  • Total RNA isolation from green leaves using an RNAeasy Plant Mini Kit or equivalent, followed by DNase I treatment to remove genomic DNA contamination

  • RT-PCR amplification of the target region containing potential editing sites

  • Direct sequencing of RT-PCR products to identify C-to-U conversions

  • Comparison of cDNA sequences with the corresponding genomic DNA sequences

  • Quantification of editing efficiency using techniques such as poisoned primer extension, high-resolution melting analysis, or next-generation sequencing

For comparative analysis across Nicotiana species, researchers should extract protein-coding genes from plastomes, align them using MAFFT, and analyze using software like DnaSP to identify variations in editing patterns .

How does the genetic background of different Nicotiana species affect cytochrome b6-f complex assembly and function?

The genetic background significantly impacts cytochrome b6-f complex assembly and function across Nicotiana species. Nicotiana tabacum, an allotetraploid derived from the progenitors of N. sylvestris and N. tomentosiformis, demonstrates complex inheritance patterns of chloroplast genes . The chloroplast genome of N. tabacum is believed to have originated from N. sylvestris , which has implications for the expression and processing of plastid-encoded genes like petD.

Research has shown that there are species-specific differences in RNA editing patterns and efficiency. For example, editing efficiency of the ndhD-1 site in N. tomentosiformis (15%) is lower than in N. tabacum (42%) and N. sylvestris (37%) . These variations are attributed to amino acid differences in editing factors such as CRR4 . Similar species-specific variations might exist for petD and other cytochrome b6-f complex subunits, potentially affecting complex assembly, stability, and function.

What is the relationship between de-etiolation and cytochrome b6-f complex assembly in Nicotiana sylvestris?

De-etiolation (the transition from dark-grown to light-grown state) significantly impacts cytochrome b6-f complex assembly in Nicotiana species. The de-etiolation-induced protein 1 (DEIP1) has been identified as a critical factor in this process. DEIP1 was discovered in a time-resolved analysis of gene expression during the greening of etiolated tobacco (Nicotiana tabacum) plants, showing pronounced early induction of mRNA accumulation in response to light signals .

Research has demonstrated that DEIP1 facilitates the assembly of core protein subunits of the cytochrome b6-f complex. Knock-out mutants of DEIP1 are incapable of photoautotrophic growth and almost completely lack fully assembled cytochrome b6-f complexes . Experimental evidence suggests that DEIP1 interacts with the cytochrome b6-f subunits PetA and PetB, indicating its direct role in complex assembly . These findings establish a mechanistic link between light-induced developmental transitions and the biogenesis of essential photosynthetic complexes including the cytochrome b6-f complex.

What is the lifetime of the cytochrome b6-f complex in Nicotiana sylvestris and how does it compare to other photosynthetic complexes?

The cytochrome b6-f complex in Nicotiana species exhibits a remarkably long lifetime, with experimental evidence suggesting a duration of at least one week. Research using ethanol-inducible RNA interference (RNAi) against essential nuclear-encoded subunits (PetC and PetM) has shown that while young expanding leaves exhibit rapid bleaching and necrosis upon RNAi induction, mature leaves whose photosynthetic apparatus was fully assembled before RNAi induction remained green .

Analysis revealed that all photosynthetic parameters in mature leaves remained indistinguishable from wild-type even after 14 days of RNAi induction, despite efficient repression of the target genes . This indicates that once assembled, the cytochrome b6-f complex remains stable and functional for extended periods. The biogenesis of the complex appears to be restricted to young leaves in tobacco, suggesting a programmed developmental regulation of complex assembly . This long lifetime may be part of an energy conservation strategy, reducing the metabolic cost of continuously replacing these elaborate protein complexes.

How do mutations in assembly factors affect the accumulation of the cytochrome b6-f complex in Nicotiana species?

Mutations in assembly factors significantly impact cytochrome b6-f complex accumulation in Nicotiana and related species. Several factors have been identified:

  • DEIP1 (De-etiolation-induced protein 1): Knockout mutants of DEIP1 are incapable of photoautotrophic growth and almost completely lack fully assembled cytochrome b6-f complexes. The deip1-1 and deip1-3 knockout mutants show reduced accumulation of not only cytochrome b6-f subunits but also subunits of PSII, PSI, and cpATP synthase (to ~25% of wild-type levels) .

  • DAC (Defective Accumulation of Cytb6f): Loss-of-function mutants display decreased accumulation of the cytochrome b6-f complex (to 10–20% of wild-type levels) and exhibit pale phenotypes. DAC interacts with PetD, though its precise mode of action remains under investigation .

  • HCF222 and HCF164: These proteins (DnaJ-like and thioredoxin-like, respectively) influence cytochrome b6-f complex accumulation through mechanisms that are still being elucidated .

  • CCB pathway proteins: The CCB pathway (Cofactor assembly, complex C (b6f), subunit B) delivers heme to the cytochrome b6 apoprotein and is essential for complex assembly .

These studies highlight the complex network of factors required for proper cytochrome b6-f complex assembly and accumulation in plant systems.

What are the current techniques for expressing recombinant petD in heterologous systems?

The expression of recombinant petD presents unique challenges due to its plastid origin and membrane protein nature. Current recommended techniques include:

Expression SystemAdvantagesLimitationsSpecial Considerations
Chloroplast TransformationProper processing and targetingTechnically demandingRequires species-specific vectors
E. coli ExpressionHigh yield, simple protocolMay form inclusion bodiesRequires codon optimization and fusion tags
Cell-Free ExpressionAvoids toxicity issuesLimited scaleSupplementation with lipids or detergents needed
Yeast SystemsPost-translational modificationsLower yield than E. coliRequires optimization of growth conditions
Insect Cell SystemsCloser to plant processingExpensiveComplex protocol development needed

For chloroplast transformation, biolistic delivery of DNA into N. sylvestris leaf tissues followed by selection on spectinomycin has proven effective. Successful expression requires proper promoter selection (typically the psbA promoter) and inclusion of 5' and 3' untranslated regions to ensure proper RNA processing .

How can researchers effectively study the impact of RNA editing on petD function in Nicotiana sylvestris?

To effectively study the impact of RNA editing on petD function, researchers should implement a multi-faceted approach:

  • Identification of editing sites: Systematic comparison of genomic DNA and cDNA sequences to identify C-to-U conversion sites within petD transcripts.

  • Quantification of editing efficiency: Use of poisoned primer extension assays, high-resolution melting analysis, or deep sequencing to determine editing efficiencies at specific sites.

  • Mutation analysis: Site-directed mutagenesis of editing sites in transformation constructs to create pre-edited or editing-deficient versions of petD.

  • Editing factor identification: Use of co-immunoprecipitation followed by mass spectrometry to identify trans-factors involved in petD editing, similar to approaches used for identifying factors like CRR4 for ndhD editing .

  • Heterologous complementation: Testing of editing factors from different Nicotiana species in Arabidopsis mutants to assess functional conservation, as demonstrated with CRR4 orthologous genes .

  • Physiological assessment: Measurement of electron transport rates, P700 oxidation kinetics, and other photosynthetic parameters to evaluate the functional consequences of altered RNA editing.

This comprehensive approach enables researchers to establish clear correlations between RNA editing events and functional outcomes in the cytochrome b6-f complex.

What new analytical techniques are emerging for studying protein-protein interactions within the cytochrome b6-f complex?

Emerging analytical techniques for studying protein-protein interactions within the cytochrome b6-f complex include:

  • Cryo-electron microscopy (Cryo-EM): Provides high-resolution structural information on intact complexes without crystallization requirements.

  • Chemical cross-linking combined with mass spectrometry (XL-MS): Identifies interaction interfaces between subunits and with assembly factors.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps dynamic interactions and conformational changes under different physiological conditions.

  • Single-molecule FRET (smFRET): Measures distances between labeled subunits to monitor assembly dynamics in real-time.

  • Native mass spectrometry: Analyzes intact membrane protein complexes to determine subunit stoichiometry and stability.

  • In-cell NMR spectroscopy: Enables structural studies of membrane proteins in near-native environments.

  • Proximity labeling techniques (BioID, APEX): Identify transient interactors involved in complex assembly or regulation.

These techniques complement traditional methods like blue-native PAGE and co-immunoprecipitation, providing unprecedented insights into the structure, assembly, and dynamics of the cytochrome b6-f complex in Nicotiana sylvestris and other plant species.

How can researchers address low yields when working with recombinant petD?

When addressing low yields of recombinant petD, researchers should consider implementing the following optimized strategies:

  • Expression system selection: Chloroplast transformation often yields better results for plastid-encoded proteins like petD compared to nuclear transformation with chloroplast targeting sequences.

  • Codon optimization: Adapting the petD coding sequence to the codon usage preferences of the expression host can significantly improve translation efficiency.

  • Solubilization optimization: Systematic screening of detergents (mild non-ionic detergents like DDM, LMNG, or GDN) at different concentrations to identify optimal solubilization conditions.

  • Fusion tags and partners: Addition of solubility-enhancing tags (MBP, SUMO, or TrxA) can improve expression and extraction yields, but may require subsequent tag removal.

  • Temperature modulation: Lowering expression temperature (16-18°C) often improves proper folding of membrane proteins.

  • Expression induction optimization: Testing different inducer concentrations and induction times to balance protein expression with proper folding.

  • Inclusion body recovery: If petD forms inclusion bodies, specialized refolding protocols using chaotropic agents followed by gradual dialysis in the presence of appropriate lipids or detergents.

  • Co-expression strategies: Co-expressing petD with other cytochrome b6-f complex subunits or molecular chaperones to enhance proper folding and complex assembly.

These approaches can be systematically tested and combined to optimize recombinant petD production for structural and functional studies.

What are the most common pitfalls in analyzing cytochrome b6-f complex assembly and how can they be avoided?

Common pitfalls in analyzing cytochrome b6-f complex assembly and recommended solutions include:

Common PitfallSolution Strategy
Degradation during isolationUse fresh tissue, keep samples cold, include protease inhibitor cocktail, and minimize handling time
Loss of subunits during purificationOptimize detergent type and concentration; use gentle extraction methods
Incorrect interpretation of assembly intermediatesInclude positive and negative controls; use multiple detection methods (Western blot with specific antibodies)
Artifactual aggregationValidate with size exclusion chromatography; compare native vs. denaturing conditions
Background signals in interaction studiesInclude appropriate negative controls in BiFC and co-IP experiments
Developmental stage variabilityStandardize sampling to specific leaf developmental stages; de novo biogenesis occurs primarily in young leaves
Species-specific differencesAccount for variations between Nicotiana species; chloroplast genome of N. tabacum originated from N. sylvestris

Additionally, researchers should be aware that cytochrome b6-f complex assembly can be influenced by growth conditions, light intensity, and stress factors. Standardizing these parameters across experiments is essential for reproducible results.

How does the petD gene and its expression differ across Nicotiana species?

The petD gene shows both conservation and variation across Nicotiana species, reflecting their evolutionary relationships. Key differences include:

  • Sequence variation: While the coding sequence of petD is highly conserved due to functional constraints, variations in non-coding regions can affect expression and processing. Comparative analyses using software like DnaSP have revealed patterns of synonymous (Ks) and non-synonymous (Ka) substitutions in protein-coding genes across Nicotiana plastomes .

  • RNA processing: Processing of petD transcripts, including splicing and editing, may vary between species. RNA editing sites have been systematically determined across Nicotiana species .

  • Regulatory elements: The expansion and contraction of inverted repeats and their border positions differ among Nicotiana species, potentially affecting gene expression .

  • Evolutionary pressure: The petD gene, like other plastid genes, shows evidence of purifying selection, with lower Ka/Ks ratios compared to nuclear genes. Fast unconstrained Bayesian approximation (FUBAR) and mixed effects model of evolution (MEME) have been used to assess the impact of positive selection on plastid genes .

  • Interspecific differences: The chloroplast genome of N. tabacum is believed to have originated from N. sylvestris , which has implications for the evolution and expression of plastid-encoded genes like petD across the genus.

These differences provide insights into the evolutionary history and functional adaptations of the cytochrome b6-f complex across the Nicotiana genus.

What insights can comparative genomics provide about the evolution of the cytochrome b6-f complex in plants?

Comparative genomics has revealed important insights about cytochrome b6-f complex evolution:

  • Structural conservation: The core components of the cytochrome b6-f complex, including petD (subunit IV), are highly conserved across plant species, reflecting the essential nature of this complex in photosynthetic electron transport.

  • Subunit origin: The complex demonstrates a mixed genetic origin, with some subunits (PetA, PetB, PetD, PetG, PetL, and PetN) encoded in the plastid genome and others (PETC and PETM) encoded in the nuclear genome , suggesting evolutionary gene transfer events.

  • Assembly factor diversification: Proteins involved in complex assembly, such as DEIP1, DAC, HCF222, and HCF164, show varying degrees of conservation across plant lineages , indicating potential species-specific adaptations in the assembly process.

  • RNA editing sites: The pattern and efficiency of RNA editing sites affect transcript processing and translation, with notable differences between Nicotiana species. For example, ndhD-1 editing efficiency varies significantly between N. tomentosiformis (15%), N. tabacum (42%), and N. sylvestris (37%) .

  • Selection pressures: Analysis of synonymous (Ks) and non-synonymous (Ka) substitution rates in plastid genes, including those encoding cytochrome b6-f complex subunits, provides evidence of selection pressures acting on these genes throughout plant evolution .

These comparative genomic insights help reconstruct the evolutionary history of this critical photosynthetic complex and understand how it has adapted to different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.