Recombinant Nicotiana sylvestris Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is synthesized using heterologous expression systems optimized for stability and yield:

  • Expression Host: Escherichia coli with N-terminal His-tag fusion for affinity purification .

  • Post-Processing: Lyophilized in Tris-based buffer with 50% glycerol for long-term storage at -20°C/-80°C .

Critical Parameters:

  • Purity: >85% (verified via SDS-PAGE) .

  • Reconstitution: Requires sterile water and glycerol aliquoting to prevent aggregation .

Functional Studies

Overexpression of related subunits (e.g., Rieske FeS in Nicotiana tabacum) enhances cytochrome b6-f complex abundance by 40%, accelerating plastoquinone oxidation and proton gradient formation . This suggests petB’s role in modulating photosynthetic efficiency under fluctuating light conditions.

Biotechnological Relevance

Studies using recombinant petB have identified bottlenecks in electron transport chains, informing strategies to improve crop yields through engineered photosynthesis .

Challenges and Future Directions

While recombinant petB has advanced photosynthetic research, challenges persist in maintaining protein stability during extraction due to its transmembrane topology . Future work may leverage cryo-EM to resolve its conformational dynamics during electron transport.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them during order placement. We will then prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nsy:3735071

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the gene structure of petB in Nicotiana species?

The petB gene in Nicotiana sylvestris and other Solanaceae species has a distinctive structure featuring:

  • Total length of approximately 1401 bp (including introns)

  • Two exons of 6 bp and 642 bp respectively

  • A single intron separating these exons

This structure with an unusually short first exon (6 bp) is characteristic of organelle genomes and is not typically observed in bacterial, fungal, or plant nuclear genomes . The petB gene is one of six cytochrome B6/F genes present in the plastomes of Solanaceae .

How does recombinant N. sylvestris cytochrome b6 differ from the native protein?

Recombinant N. sylvestris cytochrome b6 is typically produced with specific tags for purification and detection purposes. While the amino acid sequence remains identical to the native protein, recombinant versions may include:

  • Tag additions (determined during the production process)

  • Storage in specialized buffers (typically Tris-based buffer with 50% glycerol)

  • Optimization for stability and specific research applications

Recombinant proteins are generally expressed using heterologous systems and purified to maintain functionality while providing research utility .

What are the optimal storage conditions for recombinant N. sylvestris cytochrome b6?

For recombinant N. sylvestris cytochrome b6 (PetB), the following storage conditions are recommended:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Once reconstituted, make aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can compromise protein integrity

The protein is typically provided in a Tris-based buffer with 50% glycerol, which helps maintain stability during storage .

What antibodies and detection methods are available for studying N. sylvestris cytochrome b6?

For immunodetection of N. sylvestris cytochrome b6, researchers can use:

  • Polyclonal antibodies raised against specific epitopes of the PetB protein

    • Example: Antibodies raised against KLH-conjugated peptides from Arabidopsis thaliana PetB (which cross-react with N. sylvestris PetB due to high sequence conservation)

    • Host organisms typically include rabbit

  • Detection methods include:

    • Western blot (WB): Recommended dilution 1:1000 - 1:5000

    • Blue native PAGE (BN-PAGE): Useful for studying protein complexes

    • Expected/apparent molecular weight: approximately 24 kDa

These antibodies typically show cross-reactivity with PetB from multiple species including A. thaliana, C. reinhardtii, and various Nicotiana species due to the high conservation of this protein .

How can I design experiments to study cytochrome b6/f complex assembly using recombinant PetB?

To study cytochrome b6/f complex assembly using recombinant PetB, consider the following experimental approach:

  • Expression of recombinant components:

    • Express recombinant PetB along with other components like PetA, PetD, and PetC

    • Consider co-expression with assembly factors like DEIP1 which has been shown to interact with PetA and PetB

  • Assembly analysis methods:

    • Blue-native polyacrylamide gel electrophoresis (BN-PAGE) to visualize intact complexes

    • Co-immunoprecipitation assays to identify protein-protein interactions

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

  • Functional validation:

    • Measure electron transfer rates

    • Assess complex stability using thermal shift assays

    • Perform complementation studies in mutant lines

Research has shown that DEIP1 (de-etiolation-induced protein 1) interacts with both PetA and PetB subunits and mediates the assembly of cytb6f complex intermediates .

How does the petB gene differ between Nicotiana sylvestris and other Nicotiana species?

While the petB gene is highly conserved among Nicotiana species, there are some notable differences:

SpeciespetB Gene CharacteristicsNotable Features
N. sylvestrisContains intron; part of maternal plastid genomeDonor of plastids to N. tabacum
N. tabacumNearly identical to N. sylvestris petBInherited plastid genome from N. sylvestris
N. tomentosiformisContains petB but in nuclear genomeMale parent of N. tabacum

N. sylvestris contributed its plastid genome (including petB) to the allotetraploid N. tabacum, while N. tomentosiformis contributed nuclear genes. This makes N. sylvestris petB particularly important for understanding the evolution of plastid genes in the Nicotiana genus .

What role does RNA editing play in petB expression in Nicotiana species?

RNA editing is a post-transcriptional process that alters the nucleotide sequence of RNA molecules. In Nicotiana species, several chloroplast genes undergo RNA editing, including some cytochrome genes, though petB specifically is not highlighted in the provided search results as undergoing extensive editing.

  • Different Nicotiana species show variation in RNA editing efficiency

    • For example, the ndhD-1 site showed editing efficiencies of:

      • N. tabacum: 42%

      • N. sylvestris: 37%

      • N. tomentosiformis: 15%

  • The editing machinery (trans-factors) can differ between species

    • The CRR4 protein, which is involved in RNA editing in chloroplasts, shows sequence variations between N. sylvestris and N. tomentosiformis that affect editing efficiency

These differences in RNA editing machinery could potentially affect petB expression and function in different Nicotiana species.

How has the cytochrome b6/f complex evolved in the Solanaceae family?

The cytochrome b6/f complex is highly conserved across the Solanaceae family, reflecting its essential role in photosynthesis. Key evolutionary aspects include:

  • Gene conservation: All six cytochrome b6/f genes (including petB) are present in the plastomes of Solanaceae species

  • Structural preservation: The complex structure, including the organization of protein subunits, is largely conserved across species

  • Maternal inheritance patterns: In allotetraploids like N. tabacum, the cytochrome genes are inherited from the maternal parent (N. sylvestris)

  • Gene arrangements: The arrangement of cytochrome genes in the plastome shows high conservation across Solanaceae members

  • Intron retention: The distinctive two-exon structure of petB with a short first exon of 6 bp and a longer second exon of 642 bp is consistently maintained across the family

This conservation highlights the essential nature of the cytochrome b6/f complex and the strong selective pressure against major changes in these genes.

How can recombinant N. sylvestris cytochrome b6 be used to study electron transport chain defects?

Recombinant N. sylvestris cytochrome b6 can serve as a valuable tool for investigating electron transport chain defects through several approaches:

  • In vitro reconstitution studies:

    • Recombinant PetB can be combined with other purified components to reconstruct partial or complete electron transport chains

    • Allows measurement of electron transfer rates under controlled conditions

    • Enables identification of rate-limiting steps in the process

  • Structure-function analyses:

    • Site-directed mutagenesis can be performed on recombinant PetB to study the impact of specific amino acid residues on function

    • Comparison of wild-type and mutant proteins can reveal critical functional domains

  • Interaction studies:

    • Using techniques like pull-down assays, surface plasmon resonance, or isothermal titration calorimetry with recombinant PetB

    • Can identify direct binding partners and quantify interaction strengths

  • Complementation experiments:

    • Introduction of recombinant PetB into knockout or knockdown lines

    • Assess rescue of phenotypes like defective photosynthesis or growth impairment

    • Research has shown that defects in assembly factors like DEIP1 result in drastically reduced accumulation of cytochrome b6/f complex subunits and disruption of photosynthetic electron transfer

What approaches can be used to study the assembly of the cytochrome b6/f complex using N. sylvestris components?

Studying cytochrome b6/f complex assembly requires multiple complementary approaches:

  • Biochemical approaches:

    • Blue-native PAGE combined with western blotting to identify assembly intermediates

    • Pulse-chase experiments to track the temporal sequence of assembly

    • Co-immunoprecipitation to identify interacting partners during assembly

    • Mass spectrometry to characterize complex composition

  • Genetic approaches:

    • Analysis of assembly factor mutants (like DEIP1) that show defects in complex formation

    • Complementation studies using wild-type and mutated components

  • Structural biology techniques:

    • Cryo-electron microscopy to visualize assembly intermediates

    • Cross-linking mass spectrometry to map protein-protein interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • In vivo tracking:

    • Fluorescently tagged components to visualize assembly in real-time

    • Bimolecular fluorescence complementation (BiFC) to detect specific interactions

Research has shown that assembly factors like DEIP1 interact with PetA and PetB to mediate assembly of intermediate complexes in the cytochrome b6/f biogenesis pathway .

How does RNA editing affect the function of cytochrome complexes in N. sylvestris compared to related species?

RNA editing can have significant impacts on cytochrome complex function by altering protein sequence and function. The comparison between N. sylvestris and related species reveals:

  • Species-specific editing patterns:

    • Different Nicotiana species show varying RNA editing efficiencies for specific sites

    • These differences are attributed to variations in trans-factors like CRR4 between species

  • Functional consequences:

    • Editing can create start codons (as seen with ndhD-1)

    • Unedited transcripts may associate with polysomes but produce non-functional proteins

    • NDH complex activity has been shown to vary between species due to editing differences

  • Evolutionary significance:

    • N. tabacum inherited editing capabilities from both parental species

    • Some editing sites are species-specific, reflecting divergent evolution

    • The ability to edit specific sites can be gained or lost during speciation

  • Trans-factors involved:

    • Proteins like CRR4 show sequence variations between N. sylvestris and N. tomentosiformis

    • These variations result in different editing efficiencies when tested in heterologous systems

While the search results don't specifically address RNA editing in petB, the mechanisms observed in other cytochrome genes likely apply to all plastid-encoded components of electron transport complexes.

What are common challenges in working with recombinant cytochrome b6 and how can they be addressed?

Researchers working with recombinant cytochrome b6 often encounter several challenges:

  • Protein stability issues:

    • Challenge: Recombinant cytochrome proteins can be unstable in solution

    • Solution: Store in appropriate buffer (Tris-based buffer with 50% glycerol); avoid repeated freeze-thaw cycles; make small working aliquots

  • Protein solubility:

    • Challenge: Membrane proteins like cytochrome b6 can aggregate

    • Solution: Include appropriate detergents; optimize protein concentration; use solubility tags during expression

  • Functional activity:

    • Challenge: Recombinant proteins may lack cofactors needed for activity

    • Solution: Reconstitute with appropriate cofactors; verify functional assays

  • Antibody specificity:

    • Challenge: Cross-reactivity with other cytochromes

    • Solution: Use validated antibodies; include appropriate controls; consider using epitope-specific antibodies targeting unique regions

  • Complex assembly:

    • Challenge: Difficulty in recreating proper complex formation in vitro

    • Solution: Co-express multiple components; include assembly factors like DEIP1; use gentle purification methods

How can researchers assess the quality and activity of recombinant N. sylvestris cytochrome b6?

Assessment of recombinant cytochrome b6 quality and activity should include:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining

    • Size exclusion chromatography

    • Mass spectrometry to confirm identity and detect modifications

  • Structural integrity:

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to evaluate tertiary structure

    • Thermal shift assays to determine stability

  • Functional activity:

    • Electron transfer assays using artificial electron donors and acceptors

    • Reconstitution with other complex components to measure complex activity

    • Spectroscopic analysis of reduced and oxidized forms

  • Interaction analyses:

    • Co-precipitation assays with known binding partners

    • Surface plasmon resonance to measure binding kinetics

    • Blue native PAGE to assess complex formation

  • In vivo complementation:

    • Introduction into knockout lines to assess functional rescue

    • Measurement of photosynthetic parameters after complementation

These approaches provide a comprehensive assessment of both structural integrity and functional activity of the recombinant protein.

What are emerging applications of recombinant cytochrome b6 in synthetic biology?

Emerging applications of recombinant cytochrome b6 in synthetic biology include:

  • Engineered photosynthetic systems:

    • Integration of cytochrome b6/f components into artificial photosynthetic apparatuses

    • Design of minimal photosynthetic units with enhanced efficiency

    • Construction of hybrid systems combining components from diverse species

  • Biosensors development:

    • Using cytochrome b6 as an electron transfer component in biosensor technologies

    • Development of redox-sensitive probes based on cytochrome structure

  • Metabolic engineering:

    • Manipulation of electron transport chains to enhance production of high-value metabolites

    • Integration into synthetic pathways requiring redox reactions

    • Similar approaches have been used with other cytochromes for production of compounds like berberine

  • Structure-based protein design:

    • Using knowledge of cytochrome b6 structure to design novel electron carriers

    • Engineering proteins with altered substrate specificity or improved stability

  • Plant biofortification:

    • Engineering of more efficient cytochrome complexes to enhance plant productivity

    • Development of crops with improved photosynthetic efficiency

How might studying N. sylvestris cytochrome b6 contribute to understanding evolutionary adaptations in photosynthesis?

Studying N. sylvestris cytochrome b6 can provide valuable insights into evolutionary adaptations in photosynthesis:

  • Comparative genomics approach:

    • Analysis of cytochrome b6 sequences across diverse plant lineages

    • Identification of conserved regions under strong selection pressure

    • Detection of lineage-specific adaptations

  • Allotetraploid evolution:

    • N. tabacum as a model for studying inheritance of organellar genomes

    • Understanding how cytochrome function is maintained after genome merger events

    • Research shows N. tabacum inherited its chloroplast genome (including petB) from N. sylvestris

  • RNA editing evolution:

    • Patterns of RNA editing differ between Nicotiana species

    • These differences reflect evolutionary changes in editing machinery

    • Comparative studies can reveal how editing processes evolve after speciation

  • Environmental adaptation mechanisms:

    • Analysis of cytochrome b6 variants from plants adapted to different light conditions

    • Correlation of sequence changes with habitat-specific requirements

    • Identification of amino acid substitutions that modify function

  • Interspecies hybridization effects:

    • Study how cytochrome function is maintained when nuclear and plastid genomes come from different species

    • Understanding compatibility mechanisms that ensure proper complex assembly

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.