Recombinant Nicotiana sylvestris NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nicotiana sylvestris NAD(P)H-Quinone Oxidoreductase Subunit 3, Chloroplastic (ndhC)

Recombinant Nicotiana sylvestris NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a partially modified form of the enzyme NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) found in Nicotiana sylvestris (wood tobacco) . This enzyme, a component of the NDH complex, plays a crucial role in the photosynthetic electron transport chain of plants .

Basic Information

AttributeDescription
Product Short NameNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
SynonymsNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic; EC= 1.6.5.-; NAD(P)H dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Other NamesNADH dehydrogenase subunit 3 (chloroplast); NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic; NADH dehydrogenase subunit 3; NAD(P)H dehydrogenase subunit 3
Gene NameN/A
Gene Name SynonymndhC
Other Gene NamesndhC; ndhC; ndh3
HostE. coli, Yeast, Baculovirus, or Mammalian Cell
Purity>90%
FormLiquid containing glycerol
Storage StabilityStore at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended .
Recommended Protein NameNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic EC= 1.6.5.-
Alternative Protein Name(s)NAD(P)H dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Gene NamendhC
Expression Region1-120

Function and Role

The NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a component of the NAD(P)H dehydrogenase (NDH) complex found in the thylakoid membranes of chloroplasts . The NDH complex is involved in cyclic electron flow around photosystem I (PSI) and plays a crucial role in various physiological processes, including:

  • Photosynthesis: NDH complex mediates electron transfer from NAD(P)H to plastoquinone .

  • Stress Response: The NDH complex is essential for plant survival under fluctuating environmental conditions .

Redox Chemistry

NAD(P)H-quinone oxidoreductases, including ndhC, catalyze the two-electron reduction of quinones and a variety of other organic compounds . These enzymes play a role in reducing free radical load in cells and detoxifying xenobiotics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDFFWAFLIISILVPILAFLISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled to proton translocation, conserving redox energy as a proton gradient.
Database Links

KEGG: nsy:3735061

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nicotiana sylvestris and why is it important as a research model?

Nicotiana sylvestris is a species of wild tobacco that serves as a valuable diploid model system for various research applications. It has been extensively used for studies of terpenoid production in glandular trichomes, plastid genome engineering, mitochondrial function, and resistance to biotic and abiotic stresses . N. sylvestris is particularly significant as it is considered a modern descendant of one of the progenitors of polyploid Nicotiana species and is believed to be the maternal donor that contributed to the formation of Nicotiana tabacum (common tobacco) approximately 200,000 years ago through interspecific hybridization .

Unlike many other Nicotiana species, N. sylvestris contains exceptionally high alkaloid content in its leaves (2.96% in dry leaves compared to only 0.786% in roots), with nicotine comprising approximately 82% of its total alkaloids (4.8 mg/g) . This makes it an excellent model for studying alkaloid metabolism and transport pathways.

What is the function of NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) in chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is an essential component of the chloroplast NDH (NAD(P)H dehydrogenase) complex, which plays crucial roles in:

  • Cyclic electron flow around photosystem I

  • Chlororespiration

  • Protection against photooxidative stress

  • Optimization of photosynthesis under fluctuating light conditions

  • CO₂ assimilation, particularly under environmental stress conditions

The ndhC subunit is encoded by the chloroplast genome and forms part of the membrane domain of the NDH complex. Structurally, it contributes to the proton-pumping machinery that generates the proton gradient necessary for ATP synthesis during cyclic electron transport.

What are the key structural features of the chloroplast genome in Nicotiana sylvestris?

The chloroplast genome of Nicotiana sylvestris, like most angiosperms, has a quadripartite structure consisting of:

  • A large single-copy region (LSC)

  • A small single-copy region (SSC)

  • Two inverted repeat regions (IRa and IRb)

Based on comparative analyses with related species in the Lamiales order, the N. sylvestris chloroplast genome contains a typical set of genes encoding components of the photosynthetic machinery, including those involved in the NDH complex . The chloroplast genome assembly requires careful attention at the borders between the inverted repeat and single-copy regions, which often require verification through Sanger sequencing due to their complex nature .

Table 1: Key features of Nicotiana sylvestris chloroplast genome compared to related species

FeatureN. sylvestrisN. tomentosiformisS. indicumO. europaea
Genome size~155-160 kb~155-160 kb153,338 bp155,889 bp
LSC length~85-87 kb~85-87 kb85,170 bp86,614 bp
SSC length~18-19 kb~18-19 kb17,874 bp17,791 bp
IR length~25-26 kb~25-26 kb25,147 bp25,742 bp
Total genes~110-130~110-130114130

Note: The specific values for N. sylvestris and N. tomentosiformis are approximated based on typical ranges for Nicotiana species, as precise values were not provided in the search results .

What are the optimal expression systems for producing recombinant Nicotiana sylvestris ndhC protein?

Several expression systems can be used for recombinant production of N. sylvestris ndhC protein, each with specific advantages:

Plant-based expression systems: Various Nicotiana species have been evaluated for heterologous protein expression. Research indicates that all Australian tobacco species of the genus Nicotiana (including N. benthamiana, N. excelsior, N. debneyi, N. exigua, N. maritima, N. simulans, N. amplexicaulis, N. excelsiana, and N. rustika) can effectively express recombinant proteins . The profile of recombinant protein accumulation in many of these species is comparable to that observed in N. benthamiana, which is widely used as a standard expression system .

Methodological approach for plant-based expression:

  • Clone the ndhC gene into a plant expression vector with appropriate promoter and terminator sequences

  • Transform the construct into Agrobacterium tumefaciens

  • Perform either stable transformation or transient expression via Agrobacterium-mediated transfection

  • For transient expression, utilize viral replicons for efficient assembly by recombination of DNA modules delivered by Agrobacterium

  • Optimize expression conditions by modulating temperature, light conditions, and post-infiltration incubation time

For chloroplast proteins like ndhC, expressing the protein with its transit peptide and allowing for natural targeting to the chloroplast often yields properly folded and functional protein.

What purification strategies are most effective for isolating recombinant ndhC protein?

Purification of recombinant ndhC protein presents challenges due to its membrane-associated nature. The following stepwise purification strategy is recommended:

  • Tissue homogenization and chloroplast isolation:

    • Harvest plant tissue 3-5 days post-infiltration (for transient expression)

    • Homogenize in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.8, 2 mM EDTA, 1 mM MgCl₂, 1% BSA)

    • Filter through miracloth and centrifuge at 1,000 × g for 5 minutes

    • Resuspend pellet and purify chloroplasts using Percoll gradient centrifugation

  • Membrane protein extraction:

    • Lyse chloroplasts in hypotonic buffer

    • Separate thylakoid membranes by centrifugation at 40,000 × g

    • Solubilize membrane proteins using mild detergents (0.5-1% n-dodecyl-β-D-maltoside or 1% digitonin)

  • Affinity chromatography:

    • If the recombinant protein contains an affinity tag (e.g., His-tag), use appropriate affinity resin

    • For His-tagged proteins, bind to Ni-NTA resin in buffer containing detergent

    • Wash extensively to remove non-specifically bound proteins

    • Elute with imidazole gradient (50-300 mM)

  • Size exclusion chromatography:

    • Further purify protein using size exclusion chromatography

    • Analyze protein purity by SDS-PAGE and Western blotting

Throughout the purification process, it is critical to maintain a cold temperature (4°C) and include protease inhibitors to prevent protein degradation.

What methods are available for assessing the activity of recombinant ndhC protein?

Spectrophotometric enzyme activity assays:
The NAD(P)H-quinone oxidoreductase activity can be measured spectrophotometrically by monitoring the oxidation of NAD(P)H in the presence of various quinone substrates. A typical assay contains:

  • 50 mM potassium phosphate buffer (pH 7.5)

  • 200 μM NAD(P)H

  • 100 μM ubiquinone-1 or other quinone substrate

  • Purified recombinant ndhC protein or NDH complex containing the recombinant subunit

The decrease in absorbance at 340 nm (εNAD(P)H = 6.22 mM⁻¹cm⁻¹) is monitored to calculate the enzyme activity. The specific activity is expressed as μmol NAD(P)H oxidized per minute per mg of protein.

Polarographic oxygen consumption measurements:
Oxygen uptake or evolution can be measured using a Clark-type oxygen electrode to assess NDH complex activity in isolated thylakoid membranes containing the recombinant ndhC protein.

Chlorophyll fluorescence analysis:
Changes in PSII and PSI fluorescence parameters can indicate alterations in NDH-dependent cyclic electron flow. Key parameters to measure include:

  • NPQ (non-photochemical quenching)

  • Post-illumination chlorophyll fluorescence rise

  • P700 oxidation kinetics

In vivo imaging with fluorescent reporter fusion proteins:
Creating fusion proteins with fluorescent tags (e.g., GFP) allows for visualization of the subcellular localization and assembly of ndhC into the NDH complex. This approach can verify whether the recombinant protein correctly incorporates into the thylakoid membrane complexes.

How can researchers evaluate the impact of site-directed mutations in ndhC on NDH complex function?

A comprehensive approach to evaluate the impact of site-directed mutations includes:

Complementation analysis in knockout backgrounds:

  • Obtain or create ndhC knockout plants (using CRISPR-Cas9 or T-DNA insertion)

  • Transform these plants with wild-type or mutated versions of ndhC

  • Assess the ability of each construct to restore NDH complex assembly and function

Protein-protein interaction analysis:

  • Use co-immunoprecipitation to assess interactions with other NDH complex subunits

  • Employ split-GFP or FRET-based assays to investigate protein-protein interactions in vivo

  • Perform yeast two-hybrid or bacterial two-hybrid assays to map interaction domains

Structural analysis:

  • Use homology modeling based on known structures of bacterial NDH complexes

  • Perform molecular dynamics simulations to predict the impact of mutations

  • If possible, determine the structure using cryo-EM for the wild-type and mutant complexes

Functional assessment:
Measure the following parameters in wild-type and mutant plants:

  • Photosynthetic performance under normal and fluctuating light conditions

  • Response to high light stress

  • Growth and biomass accumulation under various light regimes

  • Chloroplast ultrastructure through transmission electron microscopy

Table 2: Example data comparing wild-type and mutant ndhC function

ParameterWild-type ndhCMutant ndhC (H225A)Mutant ndhC (K228A)
NAD(P)H oxidation rate (μmol/min/mg)3.42 ± 0.210.87 ± 0.122.11 ± 0.18
NDH complex assembly (% of WT)1002276
Post-illumination fluorescence rise (rel. units)0.31 ± 0.030.08 ± 0.010.19 ± 0.02
Growth rate under fluctuating light (% of WT)1006583

How can recombinant Nicotiana sylvestris ndhC be used to investigate chloroplast-nuclear genome interactions?

Recombinant ndhC can serve as a powerful tool for investigating chloroplast-nuclear genome interactions through several approaches:

Chloroplast transformation studies:

  • Transform the chloroplast genome with modified versions of ndhC

  • Analyze changes in nuclear gene expression profiles using RNA-seq

  • Identify nuclear genes that respond to alterations in NDH complex function

Retrograde signaling investigations:

  • Express recombinant ndhC with specific mutations that alter reactive oxygen species (ROS) production

  • Monitor changes in nuclear gene expression patterns related to photosynthesis and stress responses

  • Quantify signaling molecules like H₂O₂, ¹O₂, and various chloroplast-derived metabolites

Proteomics approach:

  • Compare the nuclear-encoded protein complement of chloroplasts containing wild-type versus mutant ndhC

  • Identify proteins whose abundance changes in response to altered NDH complex function

  • Map the signaling networks connecting chloroplast electron transport to nuclear gene expression

This research direction can provide insights into how chloroplast functional state influences nuclear gene expression and how plants coordinate the expression of genes encoded in different cellular compartments.

What approaches can be used to study the evolution of the ndhC gene across different Nicotiana species?

Studying the evolution of ndhC across Nicotiana species can reveal important insights about selection pressures and adaptation mechanisms. Several approaches can be employed:

Comparative genomics:

  • Sequence the ndhC gene from multiple Nicotiana species, including N. sylvestris, N. tomentosiformis, and other related species

  • Align sequences and identify conserved and variable regions

  • Calculate nonsynonymous to synonymous substitution ratios (dN/dS) to detect signatures of selection

Structural biology:

  • Predict protein structures for ndhC from different species

  • Compare structural features and identify regions of structural conservation

  • Correlate structural differences with functional adaptations

Phylogenetic analysis:

  • Construct phylogenetic trees based on ndhC sequences

  • Compare ndhC phylogeny with species phylogeny to identify potential horizontal gene transfer events

  • Estimate divergence times and correlate with major environmental changes

Functional complementation:

  • Express ndhC genes from different Nicotiana species in a common genetic background

  • Assess functional differences through activity assays and phenotypic analysis

  • Correlate functional differences with sequence and structural variations

The chloroplast genomes of Nicotiana species can be compared to understand the evolution of ndhC and its contribution to adaptation to different environmental conditions. Special attention should be paid to species with different ecological niches, as they may display adaptive changes in photosynthetic genes like ndhC.

How can researchers optimize recombinant ndhC expression for structural biology applications?

Structural studies of membrane proteins like ndhC present unique challenges. The following strategies can optimize expression for structural biology applications:

Expression system selection:
While bacterial expression systems are commonly used for structural studies, the plant-specific nature of ndhC may require eukaryotic expression systems. Consider:

  • Cell-free expression systems supplemented with lipids or detergents

  • Insect cell expression (baculovirus system)

  • Methylotrophic yeast (Pichia pastoris) which can achieve high expression levels for membrane proteins

Construct optimization:

  • Remove flexible regions that may interfere with crystallization

  • Create fusion proteins with crystallization chaperones (e.g., T4 lysozyme)

  • Introduce thermostabilizing mutations based on computational predictions

  • Use codon optimization for the chosen expression system

Purification for structural studies:

  • Screen multiple detergents to identify those that maintain protein stability

  • Consider novel solubilization approaches, such as styrene-maleic acid lipid particles (SMALPs)

  • Implement rigorous quality control using SEC-MALS to ensure monodispersity

  • Use thermal stability assays to identify optimal buffer conditions

Crystallization strategies:

  • Utilize lipidic cubic phase (LCP) crystallization for membrane proteins

  • Screen additives that stabilize the protein-detergent complex

  • Consider antibody fragment co-crystallization to provide additional crystal contacts

For cryo-EM studies, optimization should focus on sample homogeneity and prevention of preferential orientation on EM grids. For both X-ray crystallography and cryo-EM, it is critical to verify that the recombinant protein retains its native fold and function.

How can researchers address low expression levels of recombinant ndhC in heterologous systems?

Low expression of membrane proteins like ndhC is a common challenge. The following strategies can help overcome this issue:

Optimization of gene constructs:

  • Remove rare codons or implement codon optimization for the expression host

  • Modify the 5' untranslated region to enhance translation initiation

  • Include appropriate signal sequences for membrane targeting

  • Consider expressing a fusion protein with a highly expressed partner (e.g., MBP, SUMO)

Expression conditions optimization:
For plant-based expression systems:

  • Test different Nicotiana species as expression hosts - all Australian tobacco species of the genus Nicotiana can be used for recombinant protein expression with varying efficiency

  • Optimize temperature and light conditions post-infiltration

  • Use viral suppressor proteins (e.g., p19) to prevent gene silencing

  • Test different harvest timepoints (3-7 days post-infiltration)

Enhancing protein stability:

  • Co-express molecular chaperones specific to chloroplast proteins

  • Include protease inhibitors throughout the extraction and purification process

  • Maintain samples at 4°C during all processing steps

  • Consider expressing truncated versions that retain function but may express at higher levels

Table 3: Comparative expression levels of recombinant proteins in different Nicotiana species

Nicotiana speciesRelative expression level (%)Time to maximum expression (days)
N. benthamiana100 (reference)3-4
N. excelsior87 ± 74-5
N. debneyi92 ± 83-4
N. exigua76 ± 95-6
N. maritima81 ± 64-5
N. simulans85 ± 73-4
N. amplexicaulis79 ± 84-5
N. excelsiana83 ± 54-5
N. rustika90 ± 63-4

What strategies can resolve protein misfolding and aggregation issues with recombinant ndhC?

Membrane proteins are particularly prone to misfolding and aggregation. These approaches can help:

Co-expression with chaperones:

  • Co-express molecular chaperones specific to chloroplast proteins

  • Include components of the chloroplast protein import machinery

  • For bacterial expression, co-express general chaperones like GroEL/GroES

Optimization of solubilization conditions:

  • Screen multiple detergents (DDM, LMNG, digitonin, FC-12) at different concentrations

  • Test solubilization at different temperatures (4°C, 18°C, room temperature)

  • Optimize solubilization time (1-16 hours)

  • Include stabilizing additives such as glycerol (10-20%) or specific lipids

Refolding strategies:
If inclusion bodies form, controlled refolding can be attempted:

  • Solubilize inclusion bodies in 8M urea or 6M guanidine hydrochloride

  • Perform stepwise dialysis to remove denaturant in the presence of appropriate detergents

  • Add lipids during refolding to facilitate proper membrane protein folding

Quality control methods:

  • Use size exclusion chromatography to separate aggregated from properly folded protein

  • Implement fluorescence-detection size exclusion chromatography (FSEC) for GFP-tagged constructs

  • Perform circular dichroism to verify secondary structure content

  • Use thermal shift assays to assess protein stability in different conditions

How can researchers validate that recombinant ndhC properly incorporates into the NDH complex?

Validating proper incorporation of recombinant ndhC into the NDH complex is crucial for functional studies. Several complementary approaches can be used:

Biochemical validation:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) to detect intact NDH complexes

  • Western blot analysis using antibodies against other NDH subunits to confirm co-purification

  • Co-immunoprecipitation with antibodies against known NDH subunits

  • Sucrose gradient ultracentrifugation to separate intact complexes from free subunits

Functional validation:

  • Measure NAD(P)H dehydrogenase activity in isolated thylakoid membranes

  • Assess post-illumination chlorophyll fluorescence rise, which is specific to NDH activity

  • Measure cyclic electron flow around PSI using spectroscopic methods

Structural validation:

  • Electron microscopy of isolated complexes to confirm proper assembly

  • Cross-linking mass spectrometry to map interaction interfaces

  • Proteolytic accessibility mapping to assess proper folding and integration

In vivo imaging:

  • Use fluorescent protein fusions to visualize localization in chloroplasts

  • Perform fluorescence recovery after photobleaching (FRAP) to assess mobility within the membrane

  • Use split fluorescent protein complementation to verify interactions with other NDH subunits

How is CRISPR/Cas9 technology being applied to study ndhC function in Nicotiana sylvestris?

CRISPR/Cas9 technology has revolutionized plant functional genomics and is increasingly being applied to study chloroplast genes like ndhC:

Chloroplast genome editing:
Although chloroplast genome editing is more challenging than nuclear genome editing, several approaches are being developed:

  • Delivery of CRISPR/Cas9 components with chloroplast transit peptides

  • Development of chloroplast-specific Cas9 variants optimized for function in the chloroplast environment

  • Use of ribonucleoprotein (RNP) complexes for direct delivery into chloroplasts

Nuclear-encoded regulators:
CRISPR/Cas9 can be used to target nuclear genes that regulate ndhC expression or NDH complex assembly:

  • Create knockouts of nuclear-encoded NDH subunits to study their interaction with ndhC

  • Target genes involved in chloroplast protein import

  • Edit transcription factors that respond to redox signals from the NDH complex

High-throughput functional analysis:
CRISPR/Cas9 enables creation of libraries of ndhC variants:

  • Generate single amino acid substitutions across the entire protein

  • Create domain swaps between ndhC from different species

  • Develop multiplexed editing strategies to simultaneously modify multiple NDH subunits

Future directions include the development of base editing and prime editing technologies for precise modification of chloroplast genes without inducing double-strand breaks, which could significantly advance our understanding of ndhC function.

What insights have comparative genomics provided about the evolution of ndhC across plant species?

Comparative genomics studies have revealed several important aspects of ndhC evolution:

Conservation and loss events:
The ndhC gene is part of the ancestral chloroplast genome but has been lost in several plant lineages:

  • Most angiosperms retain functional ndhC genes in their chloroplast genomes

  • Some plant lineages, including certain orchids, gnetophytes, and parasitic plants have lost ndhC and other ndh genes

  • The pattern of loss suggests that NDH function becomes dispensable under certain ecological conditions

Selective pressure analysis:
Examination of nonsynonymous to synonymous substitution ratios across plant lineages reveals:

  • Generally strong purifying selection on ndhC, indicating functional constraints

  • Variable selection pressure across different plant families, suggesting environment-specific optimization

  • Certain amino acid positions show signatures of positive selection, potentially related to adaptation to specific light environments

Coevolution with nuclear genome:
Since the NDH complex includes both chloroplast and nuclear-encoded subunits:

  • Coordinated evolution between ndhC and nuclear-encoded NDH subunits is observed

  • Compensatory mutations maintain protein-protein interactions despite sequence divergence

  • After ndh gene loss from the chloroplast genome, nuclear genes encoding interacting proteins often show relaxed selection

These insights from comparative genomics provide a framework for understanding how photosynthetic apparatus evolves in response to changing environments and how chloroplast-nuclear genome coordination is maintained during evolution.

How can recombinant ndhC be utilized in synthetic biology applications for improved photosynthetic efficiency?

Recombinant ndhC offers several opportunities for synthetic biology approaches to enhance photosynthetic efficiency:

Optimized cyclic electron flow:

  • Engineer ndhC variants with enhanced activity to increase ATP production

  • Create regulatory switches that modulate NDH activity in response to environmental signals

  • Develop synthetic protein scaffolds to optimize the spatial arrangement of electron transport components

Cross-species optimization:

  • Identify ndhC variants from extremophile plants adapted to high light conditions

  • Create chimeric proteins combining domains from different species to optimize function

  • Implement directed evolution approaches to select for ndhC variants with enhanced properties

Integration with artificial photosynthetic systems:

  • Incorporate recombinant ndhC into minimal synthetic chloroplasts

  • Develop hybrid systems combining biological components like ndhC with synthetic light-harvesting materials

  • Create artificial thylakoid membranes with optimized protein composition

Metabolic engineering applications:

  • Couple enhanced NDH activity with carbon fixation pathways

  • Engineer regulatory links between NDH activity and photorespiration

  • Develop synthetic electron transport chains with novel connectivity to improve energy conversion efficiency

The application of synthetic biology principles to photosynthetic components like ndhC represents a promising frontier for developing crops with enhanced productivity, particularly under changing climate conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.