Recombinant Nicotiana sylvestris NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Nicotiana sylvestris NAD(P)H-Quinone Oxidoreductase Subunit 4L (ndhE)

Recombinant Nicotiana sylvestris NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE) is a recombinant protein derived from Nicotiana sylvestris, a diploid Nicotiana species. This subunit is part of the chloroplast NADH dehydrogenase (NDH) complex, which plays a critical role in photosynthesis and chlororespiration by transferring electrons from NAD(P)H to plastoquinone (PQ) . The recombinant form is engineered with an N-terminal His-tag for purification and expressed in E. coli .

Functional Role and Biological Significance

The ndhE subunit is integral to the NDH complex, which:

  1. Mediates cyclic electron flow (CEF) in chloroplasts, contributing to ATP synthesis.

  2. Participates in chlororespiration, a process linked to PQ reduction under stress conditions .

  3. Interacts with plastoglobules, influencing prenylquinone metabolism (e.g., plastochromanol-8 and phylloquinone) .

Key Findings:

  • Recombinant Expression: The His-tagged ndhE is used in biochemical assays to study subunit interactions and electron transfer mechanisms .

  • Cross-Species Reactivity: Antibodies against ndhE show reactivity with Arabidopsis thaliana, Spinacia oleracea, and other plants, indicating conserved epitopes .

Applications in Research and Biotechnology

ApplicationDetailsSource
ELISA KitsUsed to quantify ndhE in plant extracts or recombinant protein preparations.
Structural StudiesHomology models inform on subunit dynamics and interactions in the NDH complex.
Vaccine ProductionNicotiana species (e.g., N. benthamiana) are used for recombinant protein expression, though ndhE-specific applications remain unreported.

Limitations:

  • Functional Studies: Limited data on ndhE’s specific catalytic role compared to other NDH subunits (e.g., NdhB, NdhD) .

  • Expression Efficiency: Recombinant yields in E. coli may vary, requiring optimization for large-scale production .

Cross-Reactivity and Immunodetection

SpeciesReactivityAntibody Source
Arabidopsis thalianaStrong reactivity with ndhE
Spinacia oleraceaConfirmed cross-reactivity
Glycine maxDetectable ndhE levels

Immunological Tools:

  • Antibodies: Polyclonal anti-ndhE antibodies are validated for Western blot and immunoprecipitation .

  • ELISA Protocols: Recombinant ndhE is used as a standard in sandwich ELISA for quantification .

Genomic and Evolutionary Context

Genomic Data:

  • Nicotiana sylvestris genomes include ndhE orthologs with high repeat content (~72%) and conserved gene clusters for terpenoid and alkaloid biosynthesis .

  • Evolutionary Significance: N. sylvestris and N. tomentosiformis are ancestral to N. tabacum, providing insights into subunit divergence in NDH complexes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your request when placing the order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Database Links

KEGG: nsy:3735063

Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) in Nicotiana sylvestris chloroplasts?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) is a critical component of the chloroplastic NAD(P)H dehydrogenase complex in Nicotiana sylvestris. This complex participates in cyclic electron flow around photosystem I, contributing to ATP synthesis without NADPH production. Methodologically, its function is typically assessed through comparative oxygen evolution measurements, electron transport rate determinations, and spectroscopic analyses of intact chloroplasts. The protein plays a crucial role in maintaining optimal photosynthetic efficiency, particularly under stress conditions, by mediating electron transfer from NAD(P)H to plastoquinone .

  • Where is the ndhE gene located in the Nicotiana sylvestris genome and how is it organized?

The ndhE gene is located in the Nicotiana sylvestris chloroplast genome, specifically within one of the conserved regions of the large single-copy (LSC) segment. Genomic analyses of Nicotiana species reveal that chloroplast genomes exhibit typical quadripartite structure with conserved gene content and order. The complete chloroplast genome of N. sylvestris has been used as a reference for assembling and analyzing other Nicotiana species genomes, indicating its importance as a model . To study the gene's location, researchers typically employ whole genome sequencing followed by annotation with specialized software like Geneious, with gene borders often visualized using tools such as IRscope .

  • What expression systems are most effective for producing recombinant Nicotiana sylvestris ndhE protein?

For recombinant expression of Nicotiana sylvestris ndhE, researchers typically employ several expression systems with varying efficiency:

Expression SystemAdvantagesLimitationsTypical Yield
E. coliRapid growth, high protein yield, cost-effectivePotential improper folding, absence of plant-specific post-translational modifications10-30 mg/L culture
YeastEukaryotic processing capability, moderate yieldLonger cultivation time than bacteria, different glycosylation patterns5-15 mg/L culture
BaculovirusPlant-like post-translational modifications, proper foldingComplex methodology, higher cost1-10 mg/L culture
Plant-basedNative-like processing and foldingLower yield, longer production time0.1-1 mg/g leaf tissue

For optimal results, expression constructs should contain plant-optimized codons, appropriate signal peptides, and purification tags that don't interfere with protein function. The choice should be determined by the specific experimental requirements, particularly whether native conformation or high yield is prioritized .

  • How does the structure of ndhE in Nicotiana sylvestris compare to homologous proteins in other plant species?

The ndhE subunit in Nicotiana sylvestris shares significant structural similarities with homologous proteins in other plant species, particularly within the Solanaceae family. Comparative analyses reveal highly conserved functional domains essential for electron transport. Structural studies indicate:

  • Core catalytic regions show >90% sequence identity among Solanaceae members

  • N-terminal transit peptides exhibit greater variability, reflecting species-specific chloroplast import mechanisms

  • Hydrophobic transmembrane domains remain highly conserved, facilitating proper membrane integration

  • Substrate binding sites display subtle species-specific variations that may influence catalytic efficiency

Methodologically, structural comparisons are typically performed using multiple sequence alignments, homology modeling based on crystallographic data from related proteins, and molecular dynamics simulations to predict conformational differences .

Advanced Research Questions

  • What methodological approaches are most effective for assessing ndhE function in Nicotiana sylvestris under varying environmental conditions?

To effectively assess ndhE function in Nicotiana sylvestris under varying environmental conditions, researchers should implement a multi-faceted approach:

  • Chlorophyll fluorescence analysis: Measure parameters including ΦPSII, NPQ, and 1-qL under different light intensities, temperatures, and drought conditions. This provides real-time assessment of electron transport efficiency.

  • Oxygen electrode studies: Quantify oxygen evolution rates in isolated chloroplasts with specific electron transport inhibitors (e.g., rotenone) to determine the relative contribution of NDH-dependent pathways.

  • Transcript and protein quantification: Implement RT-qPCR and western blot analyses to monitor ndhE expression levels under stress conditions. Target specific protocol:

    • RNA extraction using modified TRIzol protocol optimized for high-polysaccharide tissues

    • cDNA synthesis with plant-specific reverse transcriptase systems

    • qPCR using primers targeting conserved ndhE regions (typical efficiency: 95-98%)

  • Transgenic approaches: Generate ndhE knockdown or knockout lines using CRISPR-Cas9 or RNAi to assess phenotypic and physiological changes.

  • Isotope labeling: Use 13C labeling combined with mass spectrometry to trace carbon fixation rates and allocation patterns.

This integrated approach allows researchers to correlate ndhE function with photosynthetic performance across environmental gradients, revealing stress-specific adaptation mechanisms .

  • Cyclic electron flow disruption: ndhE mutations reduce cyclic electron flow around PSI by 40-65% under high light conditions, leading to decreased ATP:NADPH ratios that impair Calvin cycle function.

  • Stress response alterations: Mutants show compromised photosynthetic efficiency particularly under drought, high temperature, and high light intensity.

  • Compensatory mechanisms: Alternative pathways activate, including:

    • Enhanced PGR5-PGRL1 dependent cyclic electron flow

    • Increased activity of matrix-facing NAD(P)H-dehydrogenase (rotenone-insensitive pathway)

    • Upregulation of AOX pathway genes

  • Developmental consequences: Severe mutations can lead to photosystem damage, reduced growth rates, and altered leaf morphology.

Methodologically, research requires precision phenotyping combining gas exchange measurements, chlorophyll fluorescence imaging, and metabolomic profiling to fully characterize the impact of specific mutations. Controlled complementation experiments using recombinant ndhE can verify if observed phenotypes are directly attributable to ndhE dysfunction .

  • What role does ndhE play in cyclic electron flow and how does this contribute to photosynthetic efficiency under stress conditions?

The ndhE subunit plays a crucial role in chloroplastic NAD(P)H dehydrogenase (NDH) complex-mediated cyclic electron flow (CEF), which becomes particularly important under stress conditions. Under normal conditions, CEF contributes approximately 15-20% of total electron flow, but this increases to 30-45% under stress.

The mechanisms through which ndhE-dependent CEF enhances stress tolerance include:

  • ATP synthesis enhancement: By recycling electrons from ferredoxin/NAD(P)H back to the plastoquinone pool without NADPH production, the NDH complex containing ndhE generates a proton gradient that drives additional ATP synthesis. This is critical during drought stress when stomatal closure reduces CO2 availability, creating an ATP:NADPH imbalance.

  • Photoprotection: CEF prevents over-reduction of the electron transport chain under high light by providing an alternative electron sink, reducing reactive oxygen species (ROS) formation by 30-50% compared to plants with impaired NDH function.

  • pH gradient regulation: The NDH complex helps maintain optimal lumen pH (approximately 5.5-6.0), which triggers non-photochemical quenching (NPQ) mechanisms and regulates photosystem II activity.

Research methodologies to study these processes include simultaneous measurements of P700 redox kinetics and chlorophyll fluorescence, in vivo spectroscopic analysis of NDH activity, and comparative physiological assessments of wild-type versus ndhE-mutant plants under controlled stress conditions .

  • How can researchers effectively purify and characterize recombinant Nicotiana sylvestris ndhE for structural studies?

Effective purification and characterization of recombinant Nicotiana sylvestris ndhE for structural studies requires a carefully optimized protocol:

  • Expression optimization

    • Express the mature protein (without transit peptide) fused to a cleavable affinity tag

    • Include stabilizing detergents (0.5-1% n-dodecyl β-D-maltoside) throughout purification

    • Maintain reducing conditions with 1-5 mM DTT or 2-mercaptoethanol

  • Purification workflow

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 7.5-8.0)

    • Polishing step: Size exclusion chromatography using Superdex 75 or 200

    • Typical final purity: >95% as assessed by SDS-PAGE and mass spectrometry

  • Structural characterization approaches

    • Circular dichroism spectroscopy to verify secondary structure (expected α-helical content: 30-40%)

    • Limited proteolysis combined with mass spectrometry to identify flexible regions

    • Thermal shift assays to determine stability and optimal buffer conditions

    • Small-angle X-ray scattering (SAXS) for initial structural envelope

  • Crystallization strategy

    • Screen multiple constructs with varying boundaries

    • Test co-crystallization with interacting partners or antibody fragments

    • Employ sitting-drop vapor diffusion with PEG-based precipitants

    • Verify crystal quality using preliminary X-ray diffraction tests

This comprehensive approach maximizes the likelihood of obtaining structural information while maintaining the protein in a native-like conformation .

  • How does the function of ndhE in Nicotiana sylvestris chloroplasts differ from its homologs in mitochondria (nad4L)?

While ndhE in chloroplasts and nad4L in mitochondria both participate in respiratory complexes, they exhibit significant functional and evolutionary differences that are important for researchers to understand:

CharacteristicChloroplastic ndhEMitochondrial nad4L
Complex locationNDH complex in thylakoid membranesComplex I in inner mitochondrial membrane
Genome encodingChloroplast genome (plastome)Typically mitochondrial genome in N. sylvestris
Electron donorPrimarily ferredoxin/NAD(P)HNADH
Electron acceptorPlastoquinoneUbiquinone
Functional roleCyclic electron flow, photoprotectionRespiratory electron transport
Response to inhibitorsInsensitive to rotenoneSensitive to rotenone
Evolutionary originCyanobacterial ancestryProteobacterial ancestry

In N. sylvestris research, the distinction is particularly important as mitochondrial Complex I dysfunction (as seen in CMS mutants lacking nad7) leads to activation of alternative NAD(P)H dehydrogenases to compensate for impaired respiration. These alternative pathways show rotenone insensitivity, similar to chloroplastic ndhE-containing complexes, but serve different metabolic purposes. Methodologically, researchers should use organelle-specific isolation techniques and selective inhibitors to distinguish between these functionally related but distinct systems .

  • What techniques are most effective for studying the interaction between ndhE and other subunits of the NAD(P)H dehydrogenase complex in Nicotiana sylvestris?

To effectively study interactions between ndhE and other subunits of the NAD(P)H dehydrogenase complex in Nicotiana sylvestris, researchers should employ a comprehensive set of complementary techniques:

These techniques provide complementary data on spatial arrangement, binding affinities, and the functional significance of interactions within the native complex environment .

Methodology-Focused Questions

  • What are the best approaches for conducting site-directed mutagenesis studies on the ndhE gene in Nicotiana sylvestris?

For conducting effective site-directed mutagenesis studies on the ndhE gene in Nicotiana sylvestris, researchers should implement a comprehensive workflow:

  • Target site selection strategy:

    • Prioritize conserved residues identified through multiple sequence alignments across diverse plant species

    • Focus on charged residues (D, E, K, R) in predicted functional domains

    • Create a gradient of mutations from conservative to non-conservative substitutions

  • Molecular techniques for chloroplast genome modification:

    • Biolistic transformation with homology-directed repair (most efficient for plastid transformation)

    • Preparation of gold particles (0.6 μm diameter) coated with 5-10 μg purified plasmid DNA

    • Selection using spectinomycin resistance (aadA gene) with typical transformation efficiency of 1-5 transformants per bombardment

  • Verification of homoplasmy:

    • Southern blot analysis using ndhE-specific probes

    • PCR-RFLP analysis exploiting restriction sites introduced with mutations

    • Multiple rounds of selection (3-4 typically required) on selective medium

  • Phenotypic characterization workflow:

    • Photosynthetic parameter measurements under standard and stress conditions

    • Growth analysis under fluctuating light conditions

    • Comparative proteomic analysis of thylakoid membrane complexes

  • Control experiments:

    • Complementation with wild-type ndhE to verify phenotype reversibility

    • Introduction of silent mutations to control for transformation effects

    • Creation of conservative mutations at non-conserved sites as negative controls

This approach enables researchers to establish structure-function relationships for specific amino acid residues within the ndhE subunit and their impacts on NDH complex assembly and function .

  • How can researchers effectively analyze the expression patterns of ndhE in different tissues and developmental stages of Nicotiana sylvestris?

To effectively analyze ndhE expression patterns across tissues and developmental stages in Nicotiana sylvestris, researchers should implement a multi-faceted approach:

  • Transcript-level analysis:

    • RT-qPCR with tissue-specific RNA extraction protocols

      • For green tissues: Modified CTAB method with high-salt precipitation

      • For roots and flowers: TRIzol-based extraction with PVP addition

    • RNA-Seq analysis with tissue-specific normalization using:

      • Recommended sequencing depth: 30-40 million paired-end reads per sample

      • Chloroplast-specific mapping parameters in alignment software

      • DESeq2 or edgeR for statistical analysis with FDR < 0.05

  • Protein-level analysis:

    • Western blotting optimized for chloroplast membrane proteins:

      • Sample preparation with 1% SDS and 60°C incubation (avoids aggregation)

      • Transfer conditions: 25V overnight at 4°C for efficient membrane protein transfer

      • Detection limits: typically 5-10 ng of purified protein

    • Proteomics approaches:

      • Blue-native PAGE followed by second-dimension SDS-PAGE for complex analysis

      • LC-MS/MS with 60-70% sequence coverage typical for membrane proteins

  • Spatial expression analysis:

    • In situ hybridization with DIG-labeled antisense RNA probes

    • Immunohistochemistry with tissue-specific fixation protocols

    • Promoter-reporter fusions in transgenic plants

  • Developmental tracking methods:

    • Time-course sampling at key developmental transitions

    • Stress induction experiments with controlled environmental parameters

    • Light/dark transitions to capture diurnal regulation patterns

This comprehensive approach allows researchers to correlate ndhE expression with tissue-specific functions and developmental requirements, particularly important given the differential expression observed between roots, leaves, and flowers in Nicotiana species .

  • What are the most reliable chloroplast isolation protocols for studying ndhE-containing complexes from Nicotiana sylvestris?

For reliable isolation of intact chloroplasts and ndhE-containing complexes from Nicotiana sylvestris, researchers should follow this optimized protocol:

  • Plant growth conditions

    • Controlled environment: 22°C, 16h light/8h dark cycle, 120-150 μmol photons m⁻² s⁻¹

    • Harvest young, fully expanded leaves (3-4 weeks old) in early morning

    • Pre-dark adaptation optional (2-4 hours) to minimize starch accumulation

  • Chloroplast isolation procedure

    • Grinding buffer composition:

      • 330 mM sorbitol

      • 50 mM HEPES-KOH (pH 7.6)

      • 1 mM MgCl₂

      • 1 mM EDTA

      • 0.1% BSA

      • 5 mM ascorbate (freshly added)

    • Tissue disruption: Brief (2-3 seconds) homogenization in chilled buffer

    • Filtration through 4 layers of miracloth

    • Differential centrifugation: 1,000g for 5 minutes, then 2,500g for 10 minutes

    • Percoll gradient purification: 40%/80% step gradient, 10,000g for 15 minutes

    • Final resuspension in sorbitol buffer without BSA

  • Complex isolation and characterization

    • Thylakoid membrane isolation:

      • Osmotic shock with 10 mM HEPES-KOH (pH 7.6)

      • Collection at 10,000g for 10 minutes

    • Mild solubilization:

      • 1% n-dodecyl β-D-maltoside or 1% digitonin

      • 15 minutes at 4°C with gentle agitation

    • Blue native PAGE:

      • 4-16% acrylamide gradient

      • 0.02% Coomassie G-250 in sample buffer

      • Running temperature: 4°C

    • In-gel activity assay:

      • 50 mM Tris-HCl (pH 7.5)

      • 0.5 mg/ml NBT

      • 0.2 mM NADH or NADPH

      • 10 μM ferredoxin (optional)

Typical yields are 5-8 mg chlorophyll per 100g fresh weight, with NDH complex representing approximately 0.5-1% of total thylakoid protein. Intactness can be verified by phase-contrast microscopy and ferricyanide reduction assays, with >85% intactness considered suitable for further analysis .

  • How can researchers effectively distinguish between the functions of chloroplastic ndhE and other NAD(P)H dehydrogenase systems in Nicotiana sylvestris?

To effectively distinguish between the functions of chloroplastic ndhE and other NAD(P)H dehydrogenase systems in Nicotiana sylvestris, researchers should implement a comprehensive differentiation strategy:

  • Selective inhibitor approach

    Enzyme SystemSelective InhibitorWorking ConcentrationSpecificity
    Mitochondrial Complex IRotenone50-100 μMHigh
    Chloroplastic NDH complexTeriflunomide20-50 μMModerate
    Alternative NAD(P)H dehydrogenasesFlavone200-500 μMModerate
    Mitochondrial external NADH dehydrogenasePlatanetin25-50 μMModerate
  • Organelle-specific activity measurements

    • Chloroplast preparation: Percoll gradient purification to ensure >90% intactness

    • Mitochondria isolation: Differential centrifugation with BSA to preserve outer membrane

    • Activity assays:

      • Chloroplastic NDH: Post-illumination chlorophyll fluorescence rise

      • Mitochondrial systems: Oxygen consumption with substrate-specific rates

  • Genetic approaches

    • Silencing or CRISPR-based knockout of ndhE gene

    • Comparison with nuclear gene knockouts affecting mitochondrial NAD(P)H systems

    • Complementation studies with differentially targeted constructs

  • Metabolic labeling and flux analysis

    • Substrate-specific 13C or 14C labeling

    • Metabolite profiling after selective inhibition

    • Correlation of fluxes with enzyme activities

This multi-faceted approach allows researchers to delineate the specific contributions of the chloroplastic ndhE-containing complex from other NAD(P)H dehydrogenase systems, particularly important given the compensatory mechanisms observed in mutants such as NMS1 and CMS that engage alternative NAD(P)H dehydrogenases when Complex I is dysfunctional .

  • What evolutionary insights can be gained from comparative analysis of ndhE sequences across Nicotiana species?

Comparative analysis of ndhE sequences across Nicotiana species provides valuable evolutionary insights through several methodological approaches:

  • Phylogenetic analysis methodology

    • Sequence acquisition: Complete chloroplast genome assembly from high-throughput sequencing

    • Alignment strategies: MAFFT algorithm with G-INS-i strategy for accurate alignment of conserved regions

    • Tree construction methods: Maximum Likelihood with appropriate nucleotide substitution models (typically GTR+G+I)

    • Statistical support: Bootstrap analysis (typically 1000 replicates) with values >70% considered significant

  • Molecular evolution parameters

    • Substitution rate analysis:

      • dN/dS ratios to detect selection pressure (typically 0.05-0.2 for conserved chloroplast genes)

      • Relative rate tests to identify lineage-specific acceleration

    • Sequence variability (SV) calculation using the formula:
      SV = (mutations + indel events)/(conserved sites + mutations + indel events) × 100%

  • Structural implications of sequence variation

    • Mapping variations onto predicted protein structures

    • Identification of conserved domains across species

    • Correlation with functional constraints

  • Progenitor identification and hybridization analysis

    • Use of ndhE sequences to trace maternal lineages in polyploid species

    • Comparison with nuclear markers to detect incongruence indicative of hybridization

    • Divergence time estimation using calibrated molecular clocks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.