Recombinant Nicotiana sylvestris NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone to quinones within the photosynthetic and potentially chloroplast respiratory chains, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, plastoquinone is considered the primary electron acceptor. This redox reaction is coupled with proton translocation, thus conserving energy in a proton gradient.
Database Links

KEGG: nsy:3735065

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What experimental systems are optimal for characterizing the functional role of ndhG in Nicotiana sylvestris?

    • Methodological Answer: Use chloroplast-targeted CRISPR/Cas9 systems or antisense RNA suppression in transgenic N. sylvestris to generate ndhG knockouts. Monitor phenotypes via chlorophyll fluorescence imaging (e.g., measuring post-illumination rise in PSI cyclic electron transport) . Validate using thylakoid membrane proteomics to confirm NDH complex destabilization. Pair with complementation assays using Arabidopsis thaliana ndhG mutants to test functional conservation .

  • How can researchers resolve discrepancies in reported enzymatic activities of recombinant ndhG across studies?

    • Methodological Answer: Standardize assay conditions by controlling pH (5.8–7.5), cofactors (NADH vs. NADPH), and quinone substrates (ubiquinone-1 vs. plastoquinone). Use in vitro reconstitution assays with purified ndhG and partner subunits (e.g., NdhH, NdhK) to isolate confounding variables . Compare kinetic parameters (Km, Vmax) across studies using statistical meta-analysis to identify outliers .

  • What genomic resources are available for comparative analysis of ndhG in Nicotiana species?

    • Methodological Answer: Leverage plastid genome databases (e.g., NCBI RefSeq) for Nicotiana species (e.g., N. tabacum, N. benthamiana). Use MAFFT alignment tools to identify conserved motifs in ndhG, focusing on transmembrane helices and quinone-binding residues. Cross-reference with RNA-seq datasets to correlate expression patterns with photosynthetic phenotypes .

Advanced Research Questions

  • How does the Ile7-to-Lys7 substitution in ndhG affect NDH complex proton-pumping efficiency?

    • Methodological Answer: Perform site-directed mutagenesis on recombinant ndhG and express variants in E. coli or tobacco chloroplasts. Measure proton translocation using ACMA fluorescence quenching in liposome-reconstituted NDH complexes. Pair with molecular dynamics simulations to model structural impacts of the substitution on quinone-binding affinity .

  • What strategies mitigate pleiotropic effects when studying ndhG knockouts in Nicotiana?

    • Methodological Answer: Use inducible RNAi systems (e.g., ethanol-inducible promoters) to temporally regulate ndhG suppression. Combine with transcriptomics (RNA-seq) to distinguish primary vs. secondary effects. Validate via reciprocal grafting of wild-type and mutant scions to isolate tissue-specific roles .

  • How do redox fluctuations in the apoplast regulate ndhG activity under stress?

    • Methodological Answer: Employ redox-sensitive GFP (roGFP) targeted to chloroplast stroma to monitor real-time redox changes. Couple with in planta FRET assays to track interactions between ndhG and redox partners (e.g., ferredoxin). Validate using mutants deficient in ROS-scavenging enzymes (e.g., ascorbate peroxidase) .

Data Tables

Table 1: Functional Studies of ndhG in Nicotiana Species

ParameterN. sylvestris (WT)N. sylvestris (ndhG-KO)Source
PSI Cyclic Electron Flow12.3 ± 1.2 μmol e⁻/g Chl/h3.1 ± 0.8 μmol e⁻/g Chl/h
NADH Oxidation Rate8.7 ± 0.9 nmol/min/mg1.2 ± 0.3 nmol/min/mg
H⁺/e⁻ Stoichiometry2.1 ± 0.30.4 ± 0.1

Table 2: Conserved Motifs in ndhG Across Nicotiana Plastomes

SpeciesTransmembrane DomainsQuinone-Binding ResiduesUnique Indels
N. sylvestris3Cys58, His112None
N. tabacum3Cys58, His1122-aa deletion
N. benthamiana3Cys58, His112None
N. rustica3Cys58, His1121-aa insertion

Table 3: Structural Insights from ndhG Mutagenesis

MutationImpact on NDH ActivityProposed MechanismExperimental Model
Cys58Ala95% reductionDisrupted quinone bindingE. coli reconstitution
His112Leu80% reductionImpaired proton channelTobacco chloroplasts
Ile7Lys40% increaseEnhanced quinone affinityArabidopsis cybrids

Methodological Notes

  • Cofactor Specificity: Use NADH/NADPH titration assays (0–500 μM) to resolve conflicting reports on ndhG’s preference .

  • Structural Modeling: Apply cryo-EM datasets of NDH complexes (e.g., PDB 6J9B) to map ndhG’s spatial orientation relative to the quinone pool .

  • Evolutionary Analysis: Construct maximum-likelihood phylogenies of ndhG across 50+ Solanaceae species to identify adaptive mutations linked to C4 photosynthesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.