Recombinant Nicotiana sylvestris Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant CP47 Chlorophyll Apoprotein

The Photosystem II (PSII) CP47 chlorophyll apoprotein (psbB) is a critical component of the oxygen-evolving complex in plant chloroplasts, serving as an inner antenna system that binds chlorophyll a and β-carotene to facilitate light harvesting . Recombinant versions of CP47, such as those derived from Nicotiana sylvestris (a wild tobacco species), are engineered for structural, functional, and biotechnological studies. These proteins are typically expressed in heterologous systems like Escherichia coli or chloroplast-transformed plants, tagged for purification, and analyzed for their role in PSII assembly and photosynthesis .

Production and Purification

Recombinant CP47 is produced using advanced biotechnological methods:

Key Steps:

  1. Gene Cloning: The psbB gene is fused with a His-tag and inserted into expression vectors .

  2. Expression: Optimized in E. coli or transplastomic Nicotiana species (e.g., N. tabacum) .

  3. Purification: Affinity chromatography via His-tag, yielding >90% purity (confirmed by SDS-PAGE) .

  4. Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Challenges:

  • Low yield in chloroplast-engineered plants due to heteroplasmy .

  • Sensitivity to freeze-thaw cycles; requires glycerol for long-term stability .

Role in PSII Assembly:

  • CP47 binds to the D1/D2 reaction center early in PSII biogenesis, forming the "RC47" subcomplex .

  • Requires auxiliary proteins like Pam68 for chlorophyll insertion and membrane integration .

Spectroscopic Properties:

  • Absorption peaks at 436 nm (Soret band) and 676 nm (Qₓ transition), with fluorescence emission at 685 nm (77 K) .

  • Blue-shifted emission in recombinant CP47 compared to native proteins, suggesting subtle structural differences .

Applications in Research:

  • Photosynthesis Studies: Used to dissect PSII assembly mechanisms and chlorophyll-protein interactions .

  • Biotechnology: Engineered CP47 aids in developing stress-tolerant crops via chloroplast transformation .

Comparative Analysis with Related Species

SpeciesNicotiana tabacum Oenothera glazioviana Synechocystis sp. PCC6803
Expression HostChloroplastE. coliNative cyanobacteria
Purity70–80%>90%>95%
Functional PSII YieldLow (heteroplasmy issue)HighHigh
Key UseIn vivo assembly studiesStructural analysisMutagenesis and biogenesis

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis of recombinant CP47 to map chlorophyll-binding sites .

  • Stress Tolerance: Leveraging CP47 overexpression to enhance photosynthetic efficiency under cold or high-light stress .

  • Synthetic Biology: Designing minimal PSII complexes for artificial photosynthesis .

This synthesis underscores recombinant CP47’s pivotal role in advancing photosynthesis research and biotechnology, despite technical challenges in production. Data from Nicotiana tabacum and other model systems provide a robust framework for extrapolating insights to N. sylvestris, pending targeted studies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function
CP47, a component of the photosystem II (PSII) core complex, plays a crucial role in binding chlorophyll and facilitating the primary light-induced photochemical reactions of PSII. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient, which subsequently drives ATP formation.
Database Links

KEGG: nsy:3735102

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How conserved is the psbB gene sequence across plant species compared to Nicotiana sylvestris?

While the search results don't specifically detail Nicotiana sylvestris psbB conservation, comparative analysis between cyanobacterial (Synechocystis 6803) and spinach psbB genes reveals significant sequence homology, with approximately 68% DNA sequence homology and 76% amino acid sequence homology . This suggests that the psbB gene in Nicotiana sylvestris likely shows similar conservation patterns with other plant species. The highly conserved nature of the hydropathy patterns between cyanobacterial and spinach CP-47 further indicates that the three-dimensional folding structure in the thylakoid membrane is remarkably preserved across evolutionarily distant photosynthetic organisms . This conservation highlights the critical importance of the CP-47 protein structure for Photosystem II function throughout the plant kingdom.

What transformation techniques are most effective for expressing recombinant psbB in Nicotiana systems?

For recombinant expression of proteins in Nicotiana systems, both direct and indirect Agrobacterium-mediated transformation methods have proven effective. The indirect method involves co-cultivation of sterile leaf explants with recombinant Agrobacterium followed by selection and regeneration of transformed tissues, while the direct method involves direct injection of Agrobacterium suspension into plant tissues . For psbB gene transformation specifically, Agrobacterium rhizogenes-mediated hairy root induction appears promising, as this system has successfully expressed other recombinant proteins in tobacco. Using binary vectors such as pBI121 containing the target gene driven by a strong promoter (like CaMV 35S) and incorporating appropriate plant signal peptides can significantly enhance expression . Confirmation of transformation should be performed using PCR amplification with gene-specific primers, as demonstrated in studies with other recombinant proteins in tobacco systems.

What expression systems yield the highest levels of functional CP-47 protein from Nicotiana sylvestris?

Optimization ParameterStrategyExpected Impact
Promoter selectionUse strong constitutive promoters (CaMV 35S) or tissue-specific promoters2-10 fold increase in expression
Codon optimizationAdapt coding sequence to Nicotiana sylvestris preferred codons1.5-4 fold increase in expression
Signal peptideInclude appropriate chloroplast targeting sequenceImproved localization and folding
Culture conditionsOptimize light, temperature, and nutrient conditions1.5-3 fold increase in expression
Selection systemEmploy efficient antibiotic selection markersHigher transformation efficiency

Alternative systems like chloroplast transformation may yield higher expression levels for chloroplast proteins like CP-47, though this approach requires specialized vectors and selection systems.

How can researchers effectively assess the chlorophyll-binding capacity of recombinant CP-47?

Assessing chlorophyll-binding capacity of recombinant CP-47 requires multiple complementary approaches. Researchers should begin with spectroscopic analyses including absorption spectra (400-700 nm range) and fluorescence emission spectra to verify chlorophyll association with the protein. Circular dichroism spectroscopy can provide information on the protein's secondary structure and how it changes upon chlorophyll binding. For quantitative binding analysis, researchers can employ isothermal titration calorimetry (ITC) or microscale thermophoresis to determine binding affinities and stoichiometry between purified CP-47 and chlorophyll molecules.

Site-directed mutagenesis studies targeting the conserved histidine residues spaced 13-14 amino acids apart in hydrophobic regions represent a powerful approach to identify specific chlorophyll-binding sites . By systematically mutating each histidine pair and analyzing the resulting changes in chlorophyll binding, researchers can map the crucial binding residues. Finally, reconstitution experiments comparing the spectral properties of the protein with bound chlorophyll versus free chlorophyll provide functional validation of binding capacity.

What methods can determine whether recombinant CP-47 properly integrates into Photosystem II complexes?

Integration of recombinant CP-47 into functional Photosystem II complexes can be assessed through multiple complementary techniques:

  • Blue native PAGE analysis: This technique separates intact protein complexes and can verify whether CP-47 associates with other PSII components.

  • Oxygen evolution measurements: Since functional PSII evolves oxygen during photosynthesis, measuring oxygen evolution rates in systems with recombinant CP-47 versus control systems can indicate functional integration.

  • Fluorescence induction kinetics: Functional PSII exhibits characteristic chlorophyll fluorescence induction patterns; altered kinetics would suggest improper CP-47 integration.

  • Electron microscopy and single particle analysis: These techniques can visualize the structural incorporation of CP-47 into PSII supercomplexes.

  • Complementation studies: Introducing recombinant CP-47 into organisms with disrupted native psbB genes (which show loss of PSII activity) and assessing recovery of photosynthetic function provides strong evidence of proper integration.

  • Co-immunoprecipitation: Using antibodies against other PSII components to pull down protein complexes and then detecting CP-47 in these complexes confirms physical association.

How do structural variations in CP-47 across different Nicotiana species affect its functionality?

While specific comparative data between Nicotiana species is not directly available in the search results, studies comparing CP-47 between evolutionary diverse organisms like cyanobacteria and higher plants provide insights into structure-function relationships. The high degree of sequence homology in the psbB gene between cyanobacteria and spinach (68% DNA and 76% protein homology) suggests similar conservation might exist among Nicotiana species.

The most functionally significant structural elements appear to be:

Minor sequence variations between Nicotiana species would likely be tolerated in non-critical regions, while variations in histidine residues or other conserved domains could significantly impact chlorophyll binding and energy transfer efficiency. Researchers investigating these differences should employ site-directed mutagenesis to systematically introduce species-specific variations into a common backbone, then assess functional impacts through spectroscopic and biophysical techniques.

What insights can comparative genomics provide about psbB evolution across tobacco species?

Comparative genomics analysis of psbB across tobacco species can reveal evolutionary patterns in this essential photosynthetic gene. Based on known homology patterns between other species (68% DNA and 76% protein sequence homology between cyanobacteria and spinach) , we would expect high conservation among more closely related Nicotiana species.

Key approaches for comparative genomic analysis include:

  • Whole-genome sequencing of multiple Nicotiana species followed by psbB identification and alignment

  • Analysis of synonymous versus non-synonymous substitution rates to identify selection pressures

  • Structural modeling of the resulting proteins to predict functional impacts of variations

  • Investigation of intron-exon boundaries and regulatory elements that may differ between species

  • Assessment of copy number variations and pseudogenes across species

The resulting data would help identify:

  • Highly conserved domains that likely serve essential functions

  • Variable regions that may confer species-specific adaptations

  • Correlation between sequence variations and ecological niches or photosynthetic efficiency

  • Potential horizontal gene transfer events from cyanobacterial ancestors

How can recombinant CP-47 be utilized for studying artificial photosynthetic systems?

Recombinant CP-47 from Nicotiana sylvestris represents a valuable component for engineering artificial photosynthetic systems due to its role in light harvesting and energy transfer. Researchers can utilize this protein to:

  • Develop minimal Photosystem II models by incorporating purified recombinant CP-47 with other core PSII components in liposomes or nanodiscs

  • Engineer hybrid systems combining CP-47 with synthetic light-harvesting molecules to enhance spectral range or energy transfer efficiency

  • Study fundamental energy transfer mechanisms by introducing site-specific modifications or fluorescent labels into recombinant CP-47

  • Create bio-inspired solar energy conversion devices that mimic natural photosynthetic processes

For optimal utilization, researchers should focus on maintaining proper protein folding and chlorophyll binding during purification and reconstitution. This requires careful buffer optimization, selective detergent usage, and controlled chlorophyll reintroduction. Functional validation of these artificial systems can be achieved through time-resolved spectroscopy to monitor energy transfer kinetics, demonstrating whether the recombinant CP-47 successfully mimics its natural function in these engineered contexts.

What genome editing approaches are most effective for modifying the psbB gene in Nicotiana sylvestris?

For precise modification of the psbB gene in Nicotiana sylvestris, several genome editing approaches can be employed with varying efficacy:

Editing ApproachEfficiency in NicotianaSpecificityTechnical ComplexityBest Application
CRISPR/Cas9Moderate to highHighModerateGene knockouts, simple edits
CRISPR/Cas12aModerateHighModerateMultiple target edits
Base editorsModerateHighModerate to highPoint mutations without DSB
Prime editingLow to moderateVery highHighPrecise substitutions, small indels
TALENsModerateHighHighSpecific modifications in repetitive regions

For chloroplast-encoded psbB modifications, specialized chloroplast transformation techniques are required. These typically involve biolistic bombardment with chloroplast-specific vectors containing homologous flanking sequences. Selection typically employs spectinomycin resistance markers, and achievement of homoplasmy (uniform modification of all chloroplast genomes) requires multiple rounds of selection.

The key challenge with modifying essential photosynthetic genes like psbB is maintaining plant viability. Research designs should include complementation strategies or inducible systems to prevent lethal phenotypes when introducing potentially disruptive modifications to this critical gene.

What strategies can address poor expression of recombinant psbB in tobacco expression systems?

When encountering poor expression of recombinant psbB in tobacco systems, researchers should systematically address several potential limiting factors:

  • Transcriptional issues:

    • Verify promoter functionality using reporter gene assays

    • Consider alternative promoters (tissue-specific or inducible)

    • Check for silencing effects by analyzing methylation patterns

  • Translational efficiency:

    • Implement codon optimization specific to Nicotiana sylvestris

    • Optimize the Kozak sequence for improved translation initiation

    • Consider including appropriate 5' and 3' UTR elements

  • Protein stability issues:

    • Include appropriate transit peptides for chloroplast targeting

    • Co-express molecular chaperones to aid proper folding

    • Add stabilizing fusion tags that can be later removed

  • Detection limitations:

    • Employ more sensitive detection methods (fluorescent tags, specialized antibodies)

    • Concentrate samples before analysis

    • Optimize protein extraction methods specifically for membrane proteins

Studies with other recombinant proteins in tobacco hairy roots have shown expression levels as low as 0.00-0.0012% of total soluble protein , indicating that sensitive detection methods may be necessary even with optimized expression systems.

How can researchers troubleshoot functional deficiencies in recombinant CP-47 protein?

When recombinant CP-47 shows functional deficiencies, systematic troubleshooting should address potential issues at multiple levels:

  • Structural integrity assessment:

    • Perform circular dichroism spectroscopy to verify secondary structure

    • Use limited proteolysis to check for proper folding

    • Employ fluorescence spectroscopy to examine tertiary structure

  • Cofactor binding analysis:

    • Quantify chlorophyll content using absorption spectroscopy

    • Verify correct chlorophyll species (a vs. b) using HPLC

    • Assess binding of other potential cofactors like carotenoids

  • Protein modification examination:

    • Check for proper post-translational modifications using mass spectrometry

    • Verify correct disulfide bond formation

    • Assess potential undesired modifications during purification

  • Interaction partner analysis:

    • Verify capacity to interact with other PSII components using pull-down assays

    • Examine lipid interactions that may be necessary for function

    • Consider the need for specific ions or cofactors

The loss of Photosystem II activity observed when the psbB gene is disrupted indicates that proper CP-47 structure and integration are absolutely essential for function. Researchers should consider that even subtle structural deviations from the native protein might significantly impact functionality, particularly concerning the conserved histidine residues that likely coordinate chlorophyll molecules .

What emerging technologies could revolutionize studies of recombinant CP-47 structure and function?

Several cutting-edge technologies show promise for advancing our understanding of CP-47 structure and function:

  • Cryo-electron microscopy: Recent advances in resolution now enable visualization of individual chlorophyll molecules within protein complexes, potentially allowing direct observation of CP-47-chlorophyll interactions at an unprecedented level of detail.

  • Single-molecule spectroscopy: These techniques can track energy transfer processes through individual CP-47 proteins, revealing heterogeneity and dynamic behaviors masked in bulk measurements.

  • Integrative structural biology approaches: Combining multiple techniques (X-ray crystallography, NMR, mass spectrometry, computational modeling) can provide comprehensive structural insights beyond what any single method can achieve.

  • Advanced genome editing: Precise modifications through prime editing or base editing can introduce subtle mutations to probe specific structure-function relationships without complete gene disruption.

  • Artificial intelligence for protein design: Machine learning approaches can help design CP-47 variants with enhanced or modified properties based on structure-function relationships derived from existing data.

  • In situ structural techniques: Methods that can examine protein structure within living cells rather than in purified systems may reveal native conformations and interactions lost during purification.

These emerging technologies could help resolve longstanding questions about CP-47 function, particularly regarding its exact role in chlorophyll binding and energy transfer to the reaction center .

How might research on recombinant CP-47 contribute to improving crop photosynthetic efficiency?

Research on recombinant CP-47 from Nicotiana sylvestris could contribute to crop improvement strategies in several ways:

  • Enhanced light harvesting: Understanding CP-47's role in light energy capture could guide engineering of crops with expanded light absorption spectra or improved energy transfer efficiency.

  • Stress tolerance optimization: Modifying CP-47 to maintain functionality under environmental stresses could enhance crop resilience to temperature extremes, high light intensity, or drought conditions.

  • Photoinhibition resistance: CP-47 variants less susceptible to damage during photoinhibition could improve sustained photosynthetic performance in field conditions.

  • Resource use efficiency: Optimized PSII architecture could improve nitrogen use efficiency by allowing plants to achieve the same photosynthetic output with reduced protein investment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.