Recombinant Nicotiana sylvestris Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

The recombinant psbA protein is a full-length (1–344 amino acids) polypeptide expressed in Escherichia coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
UniProt IDQ3C1G3
Molecular Weight~38 kDa (calculated)
Purity>90% by SDS-PAGE
StorageLyophilized powder in Tris/PBS buffer with 50% glycerol at -20°C/-80°C
Sequence FeaturesIncludes Mn-binding clusters, βA-βB loop, and reaction center domains

The amino acid sequence begins with MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI..., retaining conserved residues essential for PSII assembly and function .

Functional Role in Photosynthesis

psbA encodes the D1 protein, which forms the PSII reaction center responsible for water splitting and oxygen evolution. Key functions include:

  • Electron Transport: Facilitates electron transfer from water to plastoquinone via tyrosine residues (Tyr-161) .

  • Photoinhibition Repair: Rapid turnover under light stress due to oxidative damage .

  • Manganese Stabilization: Coordinates the Mn₄CaO₅ cluster critical for water oxidation .

Studies in Nicotiana plastids demonstrate that the psbA promoter drives high expression of transgenes like GFP and aadA (spectinomycin resistance) .

3.2. Plastid Transformation

  • Homologous Recombination: Integration of psbA-driven aadA/GFP cassettes into plastid DNA (ptDNA) achieves 80% regeneration efficiency in tobacco .

  • Selection Markers: Spectinomycin resistance enables isolation of transplastomic lines .

3.3. Industrial and Diagnostic Use

  • ELISA Standards: Commercial kits utilize recombinant psbA for quantifying native D1 protein levels .

  • Host Cell Protein (HCP) Monitoring: Detected in downstream biopharmaceutical processes (p-value: 0.005) .

4.1. Plastid Transformation Efficiency

  • Tobacco: 85 shoots regenerated from 7,000 explants treated with psbA-aadA constructs .

  • Kenaf: Silwet L-77 pretreatment improved ptDNA integration by 40% .

4.2. Stability and Inheritance

  • Retention: 68/85 tobacco transformants retained integrated ptDNA after 4 months .

  • Germination: Seeds from transplastomic plants showed >80% viability .

4.3. Cross-Species Conservation

  • Chloroplast Genomes: psbA is conserved across Nicotiana species (N. sylvestris, N. tabacum), with identical codon usage in photosynthetic tissues .

Challenges and Innovations

  • Expression Variability: Recombinant psbA accumulation in chloroplasts remains unpredictable, necessitating codon optimization .

  • Cryopreservation: Lyophilization in trehalose buffers maintains stability for long-term storage .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Nicotiana sylvestris (Wood tobacco) (South American tobacco)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient subsequently used for ATP formation. PSII comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links

KEGG: nsy:3735101

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA gene in Nicotiana sylvestris and how does it function within the photosynthetic apparatus?

The psbA gene in Nicotiana sylvestris encodes the D1 protein (PsbA), a core component of photosystem II (PSII). This protein plays a critical role in photosynthetic electron transport and is essential for the water-splitting reaction that generates molecular oxygen. In cyanobacteria like Thermosynechococcus elongatus, which share functional similarities with higher plants, the psbA gene typically exists as a small gene family with multiple copies (psbA1, psbA2, psbA3) that encode slightly different protein variants optimized for various environmental conditions . Nicotiana species likely maintain similar gene organization, though expression patterns may differ from cyanobacterial models.

In photosynthetic organisms, the D1 protein contains binding sites for electron transport cofactors including the manganese cluster of the oxygen-evolving complex, tyrosine Z, P680 (the primary electron donor), pheophytin (the primary electron acceptor), and the QB binding site. Research approaches typically focus on the protein's role in maintaining photosynthetic efficiency under various environmental conditions.

What methods are recommended for genetically modifying the psbA gene in Nicotiana sylvestris?

For targeted modification of the psbA gene in Nicotiana sylvestris, researchers should consider homologous recombination-based methodologies adapted from approaches used in other photosynthetic organisms. A promising strategy involves:

  • Constructing a targeting vector containing:

    • Upstream and downstream homologous regions flanking the psbA target site

    • The desired mutation within the psbA sequence

    • An appropriate selection marker (e.g., antibiotic resistance)

  • Transformation methodology:

    • Agrobacterium-mediated transformation for efficient nuclear gene targeting

    • For chloroplast transformation (where psbA resides), biolistic methods using high-pressure helium to introduce DNA-coated gold particles

The approach should be derived from homologous recombination methods that have proven successful in other organisms, such as those used for Chlamydomonas reinhardtii . In these systems, selection can be performed even without direct positive selection markers by screening for specific phenotypic changes in photosynthetic activity.

How can researchers differentiate between natural and recombinant PsbA proteins in experimental systems?

Differentiating between native and recombinant PsbA proteins requires sophisticated analytical techniques due to their high sequence similarity. Recommended approaches include:

  • Mass spectrometry-based identification:

    • Reverse phase-LC-electrospray mass ionization-MS/MS (RP-LC-ESI-MS/MS) has been effectively used to quantify different PsbA variants in cyanobacteria

    • This technique can detect subtle amino acid differences between native and recombinant proteins

  • Epitope tagging strategies:

    • Introducing unique epitope tags to recombinant proteins

    • Verification through Western blotting with tag-specific antibodies

  • Site-specific mutations as markers:

    • Introduction of silent mutations creating unique restriction sites

    • Confirmation through restriction digestion of PCR-amplified sequences

The methodology must be optimized to account for the membrane-bound nature of PsbA and its hydrophobicity, which can complicate protein extraction and analysis.

What spectroscopic methods provide the most valuable information about recombinant PsbA protein function in Nicotiana sylvestris?

Several spectroscopic techniques offer critical insights into recombinant PsbA function:

When applying these methods to Nicotiana sylvestris, researchers should establish baseline measurements with wild-type plants before characterizing recombinant variants to enable accurate comparative analysis.

What are the methodological considerations for studying PsbA protein turnover in high light conditions in Nicotiana sylvestris?

Studying PsbA protein turnover under high light conditions requires careful experimental design:

  • Pulse-chase labeling approach:

    • Culture plants with 15N-labeled nitrogen sources

    • Transfer to non-labeled medium during high light treatment

    • Sample at specific time points (e.g., 0, 1.5, 3, and 6 hours)

    • Quantify labeled vs. unlabeled protein using mass spectrometry

  • Parallel quantification of transcripts and proteins:

    • Extract RNA for quantitative real-time PCR of psbA transcripts

    • Isolate protein fractions for MS-based protein quantification

    • Compare transcript and protein dynamics to identify regulatory mechanisms

  • Experimental light treatment parameters:

    • Standard growth conditions: 50 μE m−2 s−1

    • High light stress conditions: 500 μE m−2 s−1

    • Temperature monitoring to distinguish between light and heat effects

Based on studies in cyanobacteria, researchers should expect significant changes in the PsbA protein pool within 1.5 hours of high light exposure, with stabilization occurring after approximately 3-6 hours of continuous treatment .

How can researchers effectively isolate active PSII complexes containing recombinant PsbA from Nicotiana sylvestris?

Isolation of active PSII complexes containing recombinant PsbA requires:

  • Thylakoid membrane preparation:

    • Tissue homogenization in isolation buffer (typically containing sorbitol, HEPES, EDTA)

    • Differential centrifugation to obtain thylakoid membrane fractions

    • Careful maintenance of low temperature throughout isolation

  • Solubilization of membrane proteins:

    • Use of mild detergents (β-dodecyl maltoside or n-dodecyl-β-D-maltoside)

    • Optimal detergent:chlorophyll ratio determination

    • Centrifugation to remove insoluble material

  • Chromatographic purification:

    • Ion exchange chromatography (typically DEAE or Q-Sepharose)

    • Size exclusion chromatography for further purification

    • Affinity chromatography if recombinant proteins contain affinity tags

  • Activity verification:

    • Oxygen evolution measurements

    • Chlorophyll fluorescence analysis

    • Spectroscopic confirmation of core complex assembly

Success rate for obtaining active complexes can be monitored by measuring photosynthetic electron transport using artificial electron acceptors like 2,6-dichlorophenolindophenol (DCPIP).

What strategies are most effective for creating knockout mutants of specific psbA gene family members in Nicotiana sylvestris?

Creating targeted knockout mutants of specific psbA family members requires:

  • Construct design for selective gene deletion:

    • Plasmid containing upstream and downstream regions of the target gene

    • Replacement of the target gene with an appropriate selection marker

    • For multiple gene deletions, sequential transformations with different markers

  • Selection strategy:

    • For chloroplast transformants, use of spectinomycin/streptomycin or chloramphenicol resistance markers

    • Growth under selective conditions with appropriate antibiotic concentrations

    • Verification of homoplasmy through multiple rounds of selection

  • Verification methods:

    • PCR confirmation of gene deletion

    • Southern blot analysis to verify complete segregation

    • RT-PCR to confirm absence of specific transcript

    • Protein analysis to confirm absence of the targeted PsbA variant

Based on approaches in cyanobacteria, researchers should consider that complete segregation of chloroplast transformants may require multiple rounds of selection due to the polyploid nature of the chloroplast genome .

How can researchers introduce specific point mutations in the psbA gene to study structure-function relationships?

To introduce specific point mutations in the psbA gene:

  • Site-directed mutagenesis approach:

    • Design of a transformation vector containing:

      • ~1-2 kb homologous flanking sequences on both sides of the mutation site

      • The desired point mutation within the psbA sequence

      • Selectable marker gene (preferably removable after selection)

  • Transformation and selection protocol:

    • For chloroplast transformation, biolistic delivery of DNA

    • Selection on medium containing appropriate antibiotics

    • Isolation of primary transformants after 4-6 weeks

    • Verification of correct integration by PCR and sequencing

  • Phenotypic characterization:

    • Analysis of photosynthetic parameters (oxygen evolution, fluorescence)

    • Growth measurements under various light/temperature conditions

    • Biochemical characterization of mutant PSII complexes

This approach has been successfully applied in Chlamydomonas reinhardtii to introduce mutations that alter heat stability of PSII , and similar methods can be adapted for Nicotiana sylvestris.

What considerations are important when designing experiments to analyze the effects of environmental stress on different psbA variants?

When analyzing environmental stress responses of psbA variants:

  • Experimental design considerations:

    • Controlled growth conditions (light intensity, temperature, humidity)

    • Precise stress application protocols (duration, intensity)

    • Appropriate controls (wild-type, empty vector controls)

    • Sufficient biological and technical replicates (minimum n=3)

  • Stress conditions relevant to psbA function:

    • High light stress (500 μE m−2 s−1 or higher)

    • Temperature stress (heat and cold)

    • Drought conditions

    • Combination of multiple stresses to reflect natural conditions

  • Multi-level analysis approach:

    • Transcriptional analysis (real-time PCR)

    • Protein quantification (mass spectrometry)

    • Functional measurements (oxygen evolution, electron transport rates)

    • Long-term growth and developmental effects

  • Data collection timeline:

    • Short-term responses (minutes to hours)

    • Medium-term adaptation (hours to days)

    • Long-term acclimation (days to weeks)

Studies in cyanobacteria suggest that different PsbA variants have evolved to optimize photosynthesis under different environmental conditions, with some variants offering better protection against photoinhibition .

What mass spectrometry approaches enable accurate quantification of different PsbA protein variants in Nicotiana sylvestris?

Accurate quantification of PsbA protein variants requires specialized mass spectrometry approaches:

  • Sample preparation protocol:

    • Isolation of thylakoid membranes

    • Enrichment of PSII complexes

    • Tryptic digestion of proteins

    • Identification of unique peptides for each PsbA variant

  • RP-LC-ESI-MS/MS methodology:

    • Reverse phase liquid chromatography separation

    • Electrospray ionization

    • Tandem mass spectrometry detection

    • Selected reaction monitoring (SRM) for quantification

  • Quantification strategy:

    • Use of stable isotope-labeled peptides as internal standards

    • Normalization to total protein content

    • Statistical analysis of multiple technical replicates

PsbA VariantDistinguishing Peptidesm/z ValuesFragment Ions
PsbA1XXXXXXXXXXXXXXXX.XXXXX.XX, XXX.XX
PsbA2XXXXXXXXXXXXXXXX.XXXXX.XX, XXX.XX
PsbA3XXXXXXXXXXXXXXXX.XXXXX.XX, XXX.XX

Note: The table above represents a framework; actual peptide sequences and m/z values would need to be determined experimentally for Nicotiana sylvestris PsbA variants .

What bioinformatic approaches are most useful for analyzing sequence variations in the psbA gene family across different Nicotiana species?

For comparative analysis of psbA sequences across Nicotiana species:

  • Sequence retrieval and alignment:

    • Collection of psbA sequences from genomic databases

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Manual curation of alignments to ensure proper codon alignment

  • Phylogenetic analysis:

    • Maximum likelihood or Bayesian inference methods

    • Appropriate nucleotide substitution models (e.g., GTR+Γ+I)

    • Bootstrap or posterior probability support assessment

    • Outgroup selection from related plant families

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify selective constraints

    • Identification of positively selected sites using methods like PAML

    • Sliding window analysis to identify regions under different selective pressures

  • Structural mapping of variations:

    • Homology modeling of PsbA protein structure

    • Mapping sequence variations onto 3D structure

    • Analysis of variations in functionally important domains

Phylogenetic approaches have been successfully applied to analyze psbA evolution in red algae (Rhodophyceae) and similar methods can provide insights into Nicotiana psbA evolution.

How can researchers effectively interpret data from photosynthetic electron transport measurements in recombinant psbA mutants?

Interpreting electron transport measurements from psbA mutants requires:

  • Standardized measurement protocols:

    • Oxygen evolution using Clark-type electrodes

    • PAM fluorometry for PSII quantum yield

    • P700 absorbance for PSI activity

    • Electrochromic shift measurements for thylakoid energization

  • Data normalization approaches:

    • Chlorophyll content normalization

    • Cell/tissue mass normalization

    • Reaction center quantification for per-PSII calculations

  • Comparative analysis framework:

    • Statistical comparison to wild-type controls

    • Multiple measurement techniques for cross-validation

    • Analysis under different light intensities and temperatures

  • Interpretation of common parameters:

Studies in cyanobacteria have shown that different PsbA variants can alter the redox potential of electron carriers and affect the probability of harmless dissipation of excess energy, which could be similarly investigated in Nicotiana systems .

What methodological approaches best facilitate investigation of the interaction between recombinant PsbA and other photosystem components?

To study PsbA interactions with other photosystem components:

  • Protein-protein interaction analyses:

    • Split-ubiquitin yeast two-hybrid system for membrane proteins

    • Co-immunoprecipitation with tagged PsbA variants

    • Crosslinking followed by mass spectrometry (XL-MS)

    • Förster resonance energy transfer (FRET) for in vivo interactions

  • Structural biology approaches:

    • Cryo-electron microscopy of isolated PSII complexes

    • X-ray crystallography (challenging but informative)

    • Hydrogen-deuterium exchange mass spectrometry for dynamic interactions

  • Functional interaction studies:

    • Simultaneous mutagenesis of PsbA and interacting partners

    • Suppressor screening to identify compensatory mutations

    • Reconstitution experiments with purified components in vitro

These approaches can help determine how recombinant PsbA variants affect the assembly, stability, and function of the entire PSII complex in Nicotiana sylvestris.

How can researchers design experiments to study the role of psbA gene family members in photoprotection mechanisms?

To investigate psbA roles in photoprotection:

  • Experimental design for photoinhibition studies:

    • Controlled high light exposure (500-2000 μE m−2 s−1)

    • Time-course sampling (0, 15, 30, 60, 120 minutes)

    • Recovery phase monitoring

    • Protein synthesis inhibitor treatments to distinguish repair from damage

  • Measurement parameters:

    • PSII quantum yield (Fv/Fm) decline and recovery

    • D1 protein turnover rates

    • Reactive oxygen species (ROS) production

    • Expression of photoprotective genes

  • Comparative analysis between variants:

    • Wild-type vs. single psbA variant expressors

    • Response to different wavelengths and intensities

    • Recovery capacity after photoinhibition

    • Adaptation to repeated stress exposures

Studies in cyanobacteria have demonstrated that the PsbA3 variant provides better protection against photoinhibition due to higher probability of harmless dissipation of excess energy , suggesting similar specialized roles may exist in Nicotiana psbA family members.

What approaches can be used to investigate the potential agricultural applications of modified psbA genes in improving crop photosynthetic efficiency?

For agricultural applications of modified psbA:

  • Field-relevant phenotyping protocols:

    • Growth measurements under fluctuating light conditions

    • Biomass accumulation under water-limited conditions

    • Canopy-level gas exchange measurements

    • Long-term yield assessments under multiple environments

  • Climate change resilience testing:

    • Combined heat and high light stress experiments

    • Drought and high light combination trials

    • Elevated CO2 response measurements

    • Recovery from extreme weather events

  • Biosafety and regulatory considerations:

    • Transgene containment strategies

    • Non-antibiotic selection markers

    • Site-specific integration approaches

    • Phenotypic stability across generations

  • Practical implementation strategies:

    • Transforming key crop species with optimized psbA variants

    • Breeding programs incorporating modified psbA alleles

    • Stacking with other photosynthesis-enhancing traits

    • Economic and yield impact modeling

When evaluating modified psbA variants for agricultural use, researchers should focus on measuring photosynthetic efficiency under realistic field conditions rather than controlled laboratory environments to accurately assess potential benefits.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.