Recombinant Nicotiana tabacum Alternative oxidase 1, mitochondrial (AOX1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AOX1; Ubiquinol oxidase 1, mitochondrial; Alternative oxidase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
70-353
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
Target Protein Sequence
AMSMALNDKQHDKKAENGSAAATGGGDGGDEKSVVSYWGVQPSKVTKEDGTEWKWNCFRP WETYKADLSIDLTKHHAPTTFLDKFAYWTVKSLRYPTDIFFQRRYGCRAMMLETVAAVPG MVGGMLLHCKSLRRFEQSGGWIKTLLDEAENERMHLMTFMEVAKPNWYERALVFAVQGVF FNAYFVTYLLSPKLAHRIVGYLEEEAIHSYTEFLKELDKGNIENVPAPAIAIDYCRLPKD STLLDVVLVVRADEAHHRDVNHFASDIHYQGQQLKDSPAPIGYH
Uniprot No.

Target Background

Function
Recombinant Nicotiana tabacum Alternative oxidase 1, mitochondrial (AOX1) catalyzes the cyanide-resistant oxidation of ubiquinol and the reduction of molecular oxygen to water. Unlike other oxidases, it does not translocate protons and is therefore not coupled to oxidative phosphorylation. AOX1 may enhance respiration under conditions of cytochrome pathway restriction or low temperatures.
Database Links

UniGene: Nta.464

Protein Families
Alternative oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Note=Mitochondrial, possibly in the inner surface of the inner mitochondrial membrane.

Q&A

What is the primary function of Alternative Oxidase 1 (AOX1) in Nicotiana tabacum mitochondria?

Alternative Oxidase 1 (AOX1) in Nicotiana tabacum is a non-energy conserving component of the mitochondrial electron transport chain (ETC) that serves dual key functions. First, AOX1 acts to dampen reactive oxygen species (ROS) generation by the ETC, providing protection against oxidative damage. Second, it facilitates carbon metabolism by uncoupling it from ATP turnover, allowing metabolic flexibility during stress conditions . Evidence for these functions comes from studies comparing wild-type tobacco with transgenic lines having either suppressed or enhanced AOX levels, which demonstrate significant differences in lipid peroxidation (a marker of oxidative damage) and sugar accumulation patterns .

Experimental studies measuring lipid peroxidation levels in tobacco plants under normal growing conditions (28°C/22°C light/dark) have confirmed that plants with suppressed AOX expression demonstrate elevated oxidative damage compared to wild-type plants, while plants with enhanced AOX expression show reduced lipid peroxidation . This inverse relationship provides strong evidence for AOX1's role in ROS management under normal physiological conditions.

How is AOX1 expression regulated in response to environmental stresses, particularly cold temperature?

AOX1 expression in Nicotiana tabacum demonstrates strong stress-responsive regulation, particularly during cold temperature exposure. When wild-type tobacco plants grown at optimal temperatures (28°C/22°C light/dark) are transferred to cold conditions (12°C/5°C), they exhibit a substantial induction of leaf Aox1a mRNA and AOX protein within 24 hours . This rapid transcriptional and translational response indicates the existence of cold-responsive regulatory elements in the AOX1 gene promoter region.

The cold-induced AOX1 expression coincides with several metabolic changes, including:

  • Large accumulation of monosaccharides

  • Increased transcript levels of genes encoding important ROS-scavenging enzymes

  • Moderate increases in lipid peroxidation

Methodologically, investigating AOX1 regulation requires a combination of:

  • RT-qPCR analysis to quantify transcript abundance

  • Western blotting to measure protein levels

  • Metabolomic approaches to track associated biochemical changes

  • Promoter analysis to identify specific stress-responsive elements

Researchers should design time-course experiments with appropriate controls to fully capture the dynamics of these regulatory mechanisms.

What experimental approaches are used to generate and validate transgenic Nicotiana tabacum with altered AOX1 expression?

Creating and validating transgenic Nicotiana tabacum with modified AOX1 expression involves several methodological steps:

  • Construction of expression vectors:

    • For overexpression: AOX1 cDNA is cloned into a plant expression vector under the control of a constitutive promoter (e.g., CaMV 35S)

    • For suppression: RNA interference (RNAi) or antisense constructs targeting AOX1 sequence

  • Transformation methods:

    • Agrobacterium-mediated transformation is the preferred method for tobacco

    • Nicotiana tabacum (cv. I 64) has been identified as particularly effective for recombinant protein production, exhibiting high transformation efficiency and protein expression

  • Selection and validation processes:

    • Initial selection on antibiotic-containing media

    • PCR screening to confirm transgene integration

    • RT-qPCR to quantify transcript levels

    • Western blotting with AOX-specific antibodies to confirm protein expression changes

    • Activity assays using oxygen consumption measurements with alternative pathway inhibitors and substrates

Challenges include achieving consistent expression levels across independent transgenic lines and avoiding unintended effects on plant development or other metabolic pathways. Multiple independent lines should be characterized to ensure reproducibility of observed phenotypes.

How does AOX1 expression correlate with carbohydrate metabolism during cold stress in tobacco?

The relationship between AOX1 expression and carbohydrate metabolism during cold stress reveals unexpected complexity. Contrary to the traditional hypothesis that AOX acts to burn excess carbohydrates, experimental evidence suggests the opposite relationship during cold stress in Nicotiana tabacum .

Research findings demonstrate:

  • Wild-type tobacco plants accumulate significant amounts of monosaccharides when exposed to cold conditions

  • Transgenic plants with suppressed AOX levels show less cold-induced sugar accumulation than wild-type plants

  • Transgenic plants with enhanced AOX levels exhibit enhanced sugar accumulation

This pattern suggests that AOX1 actually aids sugar accumulation during cold stress, rather than consuming excess carbohydrates. Methodologically, this relationship can be investigated through:

  • Detailed carbohydrate profiling (HPLC analysis of soluble sugars)

  • Measurement of enzyme activities in carbohydrate metabolism pathways

  • Isotope labeling studies to track carbon flux

  • Correlation analysis between AOX activity and sugar levels across different genetic backgrounds and stress conditions

These findings highlight the importance of reassessing established hypotheses with rigorous experimental approaches and considering context-specific functions of metabolic components.

What cellular markers indicate successful AOX1 function in Nicotiana tabacum?

Successful AOX1 function can be assessed through multiple cellular markers:

  • Oxidative stress indicators:

    • Reduced lipid peroxidation levels

    • Lower hydrogen peroxide content

    • Decreased protein carbonylation

    • Enhanced antioxidant enzyme activities (e.g., superoxide dismutase, catalase)

  • Respiratory parameters:

    • Increased cyanide-resistant respiration

    • Altered ATP/ADP ratio

    • Changed NADH/NAD+ balance

  • Sugar metabolism markers:

    • Enhanced sugar accumulation during cold stress

    • Altered glycolytic enzyme activities

    • Changed carbon flux through respiratory pathways

  • Stress adaptation indicators:

    • Improved cold tolerance phenotypes

    • Enhanced recovery after stress exposure

    • Maintenance of photosynthetic efficiency under stress

Experimental evidence has confirmed that under normal growth conditions (28°C/22°C), plants with enhanced AOX levels show reduced lipid peroxidation compared to wild-type plants, while plants with suppressed AOX exhibit elevated oxidative damage . This inverse relationship provides a reliable marker for assessing AOX1 functionality in genetic studies.

What explains the discrepancy between AOX1's role in oxidative stress management under normal versus cold stress conditions?

A significant research challenge is reconciling the contradictory observations that while AOX1 levels inversely correlate with lipid peroxidation under normal growing conditions, this relationship doesn't hold during cold stress . This apparent discrepancy requires sophisticated experimental design and data analysis approaches.

Methodological considerations for investigating this paradox include:

  • Time-course experiments with high temporal resolution:

    • Tracking AOX expression, ROS formation, and antioxidant system dynamics during the transition from normal to cold conditions

    • Identifying potential phase-shifts or threshold effects in these relationships

  • Subcellular localization studies:

    • Examining potential stress-induced changes in AOX1 protein localization

    • Investigating interactions with other mitochondrial components under different conditions

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Identifying condition-specific regulatory networks and feedback mechanisms

  • Targeted redox proteomics:

    • Examining redox modifications of AOX1 and interacting proteins

    • Investigating how cold stress might alter post-translational regulation

A testable hypothesis is that cold stress activates additional protective mechanisms that mask or override the direct AOX1-lipid peroxidation relationship, potentially through induction of cold-responsive antioxidant systems or changes in membrane composition that affect lipid peroxidation dynamics independently of AOX1 activity.

How do alternative splicing events affect AOX1 expression and function in different tobacco tissues?

Recent transcriptomic analysis of Nicotiana tabacum has revealed extensive alternative splicing (AS) across the tobacco genome, with a total of 207,689 transcripts identified from 599 transcriptome datasets derived from 13 different tissues . This complexity likely extends to AOX1 expression, affecting its tissue-specific functions.

Methodological approaches to investigate AS events in AOX1 include:

  • Transcript isoform identification:

    • RNA-seq with sufficient depth to capture low-abundance transcripts

    • Pacific Biosciences or Oxford Nanopore long-read sequencing to resolve full-length transcripts

    • Comparison of transcripts annotated in the reference genome with newly annotated transcripts

  • Tissue-specific expression analysis:

    • Quantification of tissue-specific transcripts using metrics like Tau values

    • Correlation of specific isoform expression with tissue function

    • Focused analysis of transcripts in stress-responsive tissues

  • Alternative splicing event (ASE) classification and quantification:

    • Analysis of specific ASE types affecting AOX1, including intron retention (RI), exon skipping (SE), alternative 3'-acceptor (A3), alternative 5'-donor (A5)

    • Calculation of percent spliced in (PSI) values to quantify splicing efficiency

  • Splicing quantitative trait locus (sQTL) analysis:

    • Integration of genetic variation data with splicing patterns

    • Identification of SNPs that regulate AOX1 ASEs

    • Analysis of cis-sVariants located within 10 kb of the ASE

Research challenges include distinguishing functional from non-functional isoforms and developing experimental systems to test the biological significance of specific splicing events in stress responses.

What are the optimal experimental parameters for expressing recombinant AOX1 in different Nicotiana species and cultivars?

Expression of recombinant AOX1 in Nicotiana requires careful optimization of multiple parameters to maximize protein yield and functionality. Comparative studies have identified significant variation in recombinant protein expression efficiency across different Nicotiana species and cultivars.

Methodological considerations include:

  • Selection of optimal Nicotiana host:

    • Nicotiana tabacum (cv. I 64) has demonstrated superior performance for recombinant protein production, with high transient expression levels, substantial biomass production, and relatively low alkaloid content

    • Among 52 evaluated Nicotiana varieties, significant differences in recombinant protein accumulation were observed in transient expression systems

  • Expression strategy optimization:

    • Transient expression: Shows significant variation among different Nicotiana hosts

    • Stable transgenic expression: Demonstrates less plant host dependency but requires longer development time

    • Subcellular targeting: Ensuring proper mitochondrial localization through appropriate transit peptides

  • Growth and induction parameters:

    • Temperature optimization (considering AOX1's temperature-responsive nature)

    • Light regime adjustment

    • Nutrient availability

    • Stress induction protocols if using stress-inducible promoters

  • Protein extraction and purification considerations:

    • Mitochondrial isolation protocols

    • Solubilization methods for membrane-associated proteins

    • Purification strategies maintaining AOX1 functionality

Research has demonstrated that while transient expression levels vary significantly among Nicotiana varieties, stable transgenic plants show less variation in recombinant protein concentration across different tobacco species . This suggests that for consistent long-term production, stable transformation may be preferable despite its longer development timeline.

How can advanced imaging techniques be applied to study AOX1 dynamics in living tobacco cells?

Advanced imaging techniques offer powerful approaches for studying AOX1 dynamics in living tobacco cells, providing insights into its subcellular localization, protein interactions, and responses to environmental stimuli.

Methodological approaches include:

  • Fluorescent protein fusions and confocal microscopy:

    • Generation of AOX1-GFP or AOX1-mCherry fusion proteins

    • Verification of fusion protein functionality through complementation assays

    • Live-cell imaging to track subcellular localization and dynamics

    • Co-localization with mitochondrial markers to confirm targeting

  • FRET/FLIM analysis for protein interactions:

    • Creation of AOX1 fusions with FRET-compatible fluorophores

    • Development of constructs for potential interaction partners

    • Measurement of FRET efficiency to quantify protein-protein interactions

    • FLIM analysis to minimize artifacts from concentration variations

  • Super-resolution microscopy:

    • STED or PALM/STORM imaging to resolve submitochondrial localization

    • Tracking of AOX1 distribution and clustering in mitochondrial membranes

    • Quantification of spatial relationships with other respiratory components

  • Biosensor development:

    • Design of genetically encoded sensors responsive to AOX activity

    • Integration with redox-sensitive fluorescent proteins

    • Real-time monitoring of AOX1-associated physiological changes

Research challenges include maintaining mitochondrial function during imaging, achieving sufficient resolution for submitochondrial structures, and developing non-disruptive tags that preserve AOX1 function. Correlation of imaging data with biochemical and physiological parameters is essential for meaningful interpretation.

What computational approaches can integrate multi-omics data to predict AOX1 regulatory networks in tobacco?

Integrating multi-omics data to elucidate AOX1 regulatory networks requires sophisticated computational approaches that can handle diverse data types and complex biological relationships.

Methodological strategies include:

  • Transcriptomic data analysis:

    • RNA-seq analysis of different tissues and stress conditions

    • Identification of co-expressed gene networks

    • Temporal expression profiling during stress responses

    • Alternative splicing analysis using tools that can identify events such as intron retention, exon skipping, and alternative donor/acceptor sites

  • Variant analysis and genetic regulation:

    • Identification of sQTLs (splicing quantitative trait loci) affecting AOX1 expression

    • Analysis of SNPs significantly associated with alternative splicing events

    • Characterization of cis-regulatory elements in the AOX1 promoter region

  • Integration frameworks:

    • Network-based approaches combining transcriptomic, proteomic, and metabolomic data

    • Bayesian network modeling to infer causal relationships

    • Machine learning approaches to identify predictive features for AOX1 expression

    • Pathway enrichment analysis to contextualize AOX1 within broader stress response networks

  • Visualization and hypothesis generation:

    • Interactive visualization tools for complex multi-omics datasets

    • Identification of key regulatory nodes and potential intervention points

    • Generation of testable hypotheses about AOX1 regulation

The comprehensive gene expression atlas of Nicotiana tabacum across various tissues, which includes RNA-seq expression profiles from 599 tobacco samples representing 13 different tissues, provides a valuable resource for such integrative analyses . This dataset enables the identification of tissue-specific expression patterns and splicing events that may regulate AOX1 function in different physiological contexts.

Comparative Analysis of AOX1 Expression and Physiological Markers in Wild-Type vs. Transgenic Tobacco

ParameterWild-Type TobaccoAOX1-Suppressed TobaccoAOX1-Enhanced TobaccoReference
Basal Aox1a mRNA (28°C/22°C)Normal levelsSignificantly reducedSignificantly elevated
Cold-induced Aox1a mRNA (12°C/5°C)Large induction within 24hMinimal inductionConstitutively high
AOX protein levels (28°C/22°C)ModerateLowHigh
Lipid peroxidation (28°C/22°C)BaselineElevated compared to WTReduced compared to WT
Lipid peroxidation (12°C/5°C)Moderate increaseVaried relationshipVaried relationship
Cold-induced sugar accumulationSignificant increaseLess than WTGreater than WT
ROS-scavenging enzyme transcriptsIncreased upon cold exposureLess induction than WTHigher basal and induced levels

Tissue-Specific Expression Patterns in Nicotiana tabacum Transcriptome

Tissue TypeTotal TranscriptsTissue-Specific TranscriptsRelevance to AOX1 Studies
Leaf (combined leaf tissues)Data extracted from 599 samplesModerate specificityPrimary tissue for cold stress studies
TrichomesData extracted from 599 samplesHighest number of tissue-specific transcriptsSpecialized metabolism interactions
RootData extracted from 599 samplesModerate specificityAlternative stress response pathway
FlowerData extracted from 599 samplesModerate specificityDevelopmental regulation patterns
SeedlingData extracted from 599 samplesLow specificityEarly developmental regulation

From the comprehensive transcriptome analysis of 599 tobacco samples from 13 tissues, researchers identified 207,689 transcripts, of which 172,170 (83%) were newly annotated, demonstrating the complexity of the tobacco transcriptome .

Alternative Splicing Events in Nicotiana tabacum Genome

Alternative Splicing Event TypeProportion in Tobacco GenomePotential Impact on Gene Function
Alternative 3'-acceptor (A3)Largest proportionAltered C-terminal protein domains
Intron retention (RI)Common in plantsPremature stop codons, NMD targeting
Exon skipping (SE)Less common than in mammalsRemoval of functional domains
Alternative 5'-donor (A5)Moderate occurrenceAltered N-terminal protein domains
Alternative first/last exon (AF/AL)Also detectedChanged protein localization signals

The study identified 107,140 alternative splicing events occurring in 17,758 genes across the tobacco genome . These findings highlight the importance of considering alternative splicing in the functional analysis of genes like AOX1.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.