Recombinant Nicotiana tabacum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKRGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVPG QKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASDGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nta:800461

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is apocytochrome f (petA) and what is its function in Nicotiana tabacum?

Apocytochrome f is a protein encoded by the petA gene located in the plastid genome of Nicotiana tabacum (tobacco). It functions as a critical component of the cytochrome b6f complex, which plays an essential role in photosynthetic electron transport. When the petA gene is inactivated or deleted from the plastid genome, plants show a complete absence of cytochrome f protein, resulting in severe photosynthetic defects . The cytochrome b6f complex mediates electron transfer between photosystem II and photosystem I, making it central to the plant's ability to harvest light energy for photosynthesis.

What are the common methods for plastid transformation in Nicotiana tabacum?

Two primary methods are used for stable plastid transformation in Nicotiana tabacum:

  • Biolistic transformation: This approach uses a particle gun to bombard young leaf tissue with DNA-coated tungsten or gold particles. The technique involves coating microprojectiles with plasmid DNA containing the gene of interest and a selectable marker gene (commonly aadA), then accelerating these particles into leaf cells using helium pressure . After bombardment, cells are regenerated on selective media containing antibiotics like spectinomycin.

  • PEG-mediated transformation: This method involves treating isolated protoplasts (plant cells with cell walls removed) with polyethylene glycol (PEG) in the presence of transformation vectors. The PEG-mediated approach offers comparable efficiency to the biolistic method, yielding between 20-50 plastid transformants per experiment (per 10^6 viable treated protoplasts) . An advantage of this technique is that it requires no expensive equipment such as a particle gun.

Both methods rely on homologous recombination events in the flanking plastid DNA sequences to integrate the transgene into the plastid genome .

How is homoplasmy achieved in transplastomic tobacco lines?

Achieving homoplasmy (the state where all copies of the plastid genome contain the transgene) is a critical step in plastid transformation research. Since a single tobacco leaf cell contains up to 10,000 identical copies of the chloroplast genome, researchers must apply high selective pressure to eliminate wild-type genomes and amplify transformed plastid DNA molecules . This is typically accomplished through:

  • Multiple rounds of regeneration on selective media containing antibiotics (typically spectinomycin when using the aadA marker gene)

  • Selection of shoots from leaf explants after each round

  • Verification of homoplasmy through DNA gel blot analysis or PCR-based screening

What strategies can address potential phenotypic challenges when expressing recombinant petA in tobacco chloroplasts?

Expressing recombinant petA in tobacco chloroplasts presents several challenges that researchers must address:

  • Photosynthetic competency: Deletion or significant modification of petA can result in photosynthetically incompetent plants, as observed in similar studies where cytochrome f was absent following gene inactivation . Researchers can implement the following strategies:

    • Use inducible expression systems to control recombinant protein production

    • Employ tissue-specific promoters to limit expression to non-photosynthetic tissues

    • Create chimeric proteins that maintain functional domains while incorporating desired modifications

  • Protein accumulation optimization: To maximize recombinant petA expression while minimizing negative impacts on plant physiology, researchers should consider:

    • Optimizing codon usage for plastid expression

    • Incorporating appropriate 5' and 3' regulatory elements

    • Testing various growth conditions to identify optimal expression parameters

    • Supplementing growth media with essential nutrients to support transplastomic plants with compromised photosynthesis

  • Selective marker removal: For applications requiring marker-free plants, researchers can implement:

    • Cre-lox recombination systems

    • Co-transformation-segregation approaches

    • Direct repeat-mediated excision of marker genes

How can genome-scale metabolic network models guide optimization of recombinant petA expression?

Genome-scale metabolic network (GSMN) models provide valuable insights for optimizing recombinant protein expression in tobacco. When working with petA, researchers can leverage these models to:

Researchers working with recombinant petA should consider incorporating flux balance analysis using these models to optimize expression conditions and predict potential metabolic consequences of their genetic modifications .

What molecular verification methods are essential for confirming successful petA modification?

Thorough molecular verification is critical when working with recombinant petA. A comprehensive verification approach should include:

  • DNA-level confirmation:

    • PCR analysis using primers flanking the integration site

    • RFLP (Restriction Fragment Length Polymorphism) analysis to verify correct integration

    • DNA sequencing to confirm the exact sequence of the integrated construct

    • Southern blot hybridization to verify copy number and homoplasmy

  • RNA-level confirmation:

    • Northern blot analysis to verify transcription of the modified petA gene

    • RT-PCR to confirm proper RNA processing

    • RNA sequencing to examine potential impacts on the plastid transcriptome

  • Protein-level confirmation:

    • Western blot analysis using anti-cytochrome f antibodies to verify protein expression

    • Blue native gel electrophoresis to examine incorporation into protein complexes

    • Mass spectrometry to confirm protein identity and potential post-translational modifications

  • Functional analysis:

    • Photosynthetic electron transport measurements

    • Chlorophyll fluorescence analysis to assess PSII/PSI function

    • Growth analysis under various light conditions to evaluate physiological impacts

What is the optimal protocol for biolistic transformation targeting petA in Nicotiana tabacum?

Based on established methodologies for plastid transformation, the following protocol is recommended for biolistic transformation targeting petA:

  • Vector construction:

    • Design a transformation vector containing:

      • The modified petA sequence

      • Flanking homologous regions (typically 1-2 kb) for targeted integration

      • A selectable marker gene (aadA) conferring spectinomycin/streptomycin resistance

      • Appropriate regulatory elements (promoters, terminators)

  • Biolistic delivery:

    • Harvest young leaves from sterile tobacco plants (N. tabacum cv. Petit Havana is commonly used)

    • Prepare tungsten or gold particles (1.0-1.1 μm diameter)

    • Coat particles with plasmid DNA following standard protocols

    • Use a biolistic device (e.g., PDS1000He; Bio-Rad) with appropriate pressure settings (1100-1350 psi)

    • Bombard leaf tissue placed on RMOP regeneration medium

  • Selection and regeneration:

    • Transfer bombarded leaves to RMOP medium containing 500 mg/L spectinomycin

    • Incubate under appropriate light conditions (16h light/8h dark cycle)

    • Excise and subculture emerging resistant shoots

    • Perform 3-4 additional regeneration cycles on selective medium to achieve homoplasmy

  • Verification:

    • Perform PCR screening of primary transformants

    • Conduct DNA gel blot analysis to verify integration and assess homoplasmy

    • Test for spectinomycin resistance in subsequent generations

How can researchers optimize PEG-mediated plastid transformation for petA studies?

PEG-mediated plastid transformation offers an alternative approach that may be particularly useful for laboratories without access to biolistic equipment. The optimized protocol includes:

  • Protoplast isolation:

    • Harvest young leaves from axenically grown tobacco plants

    • Prepare an enzyme solution containing cellulase and macerozyme

    • Digest leaf tissue overnight to release protoplasts

    • Purify protoplasts through filtration and density gradient centrifugation

  • Transformation procedure:

    • Mix purified protoplasts with transformation vector DNA

    • Add PEG solution (typically 40% PEG 4000) dropwise while gently mixing

    • Incubate for 5-30 minutes at room temperature

    • Gradually dilute the PEG with a series of wash solutions

  • Culture and selection:

    • Culture transformed protoplasts in liquid medium or embed in thin-alginate layers

    • After cell wall regeneration, transfer to selective medium containing spectinomycin

    • Regenerate plants following standard protocols

    • Subject regenerated plants to additional rounds of selection

The PEG method can achieve transformation efficiencies comparable to biolistic approaches (20-50 transformants per 10^6 viable protoplasts) while eliminating the need for expensive equipment. The critical factors for success are careful protoplast handling and optimized culture conditions .

What controls and experimental validations are necessary when studying recombinant petA function?

Rigorous experimental design is essential when studying recombinant petA. Key controls and validations should include:

  • Genetic controls:

    • Wild-type plants (negative control)

    • Plants transformed with non-modified petA (positive control)

    • Plants with known photosynthetic mutant phenotypes for comparison

  • Molecular validation:

    • Comprehensive DNA, RNA, and protein analysis (as described in section 2.3)

    • Verification of homoplasmy through multiple methods

    • Quantification of recombinant protein levels in different tissues and developmental stages

  • Functional validation:

    • Photosynthetic parameter measurements (oxygen evolution, electron transport rates)

    • Growth analysis under various light intensities

    • Chlorophyll fluorescence measurements to assess PSI and PSII function

    • Analysis of thylakoid membrane complex assembly using blue native gels

  • Environmental testing:

    • Evaluation under different growth conditions (light intensity, photoperiod, temperature)

    • Stress response assessment (drought, high light, temperature extremes)

    • Comparison of in vitro versus soil-grown plants to account for cultivation effects

A comprehensive validation approach should examine not only the presence and expression of the recombinant petA but also its functional integration into the photosynthetic apparatus and subsequent impacts on plant physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.