Recombinant Nicotiana tabacum ATP synthase protein MI25

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Physiology

ATP synthase protein MI25 is a nuclear-encoded subunit of the chloroplast ATP synthase complex, critical for photosynthetic ATP production. Studies in tobacco (Nicotiana tabacum) reveal:

  • Regulation of Photosynthesis: ATP synthase adjusts ATP/NADPH output to meet metabolic demands. Repression of ATP synthase via antisense RNA or chloroplast genome editing reduces photosynthetic efficiency and activates photoprotective mechanisms under low light .

  • Growth Impacts: Transgenic tobacco lines with <10% ATP synthase content exhibit stunted growth due to impaired ATP synthesis and increased proton motive force (pmf) across thylakoid membranes .

Applications in Research

This recombinant protein serves as a tool for:

  • Enzyme Kinetics: Studying ATP hydrolysis/synthesis mechanisms in vitro.

  • Structural Biology: Analyzing subunit interactions and conformational changes.

  • Plant Biotechnology: Optimizing photosynthetic efficiency in crops via genetic engineering .

  • Diagnostic Assays: Used as an antigen in ELISA kits for protein quantification .

Production and Optimization

  • Expression Systems: High-yield production in E. coli ensures cost-effective scalability . Nicotiana tabacum itself is also a robust host for recombinant proteins, with cv. I 64 showing superior transient expression levels .

  • Storage Stability: Lyophilization with trehalose preserves activity, while glycerol (5–50%) enhances long-term stability .

Key Research Findings

Studies using recombinant ATP synthase protein MI25 and related mutants have revealed:

ObservationExperimental ModelImpactSource
ATP synthase content correlates with CO₂ assimilation ratesAntisense AtpC mutantsPhotosynthesis limited by ATP availability
Low ATP synthase levels increase pmfatpB translation mutantsActivates non-photochemical quenching (NPQ)
E. coli-expressed protein retains native conformationRecombinant MI25Validates utility for structural studies

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity, necessitating single-use aliquots .

  • Biotechnological Applications: Leveraging tobacco’s high biomass yield for scalable production .

  • Mechanistic Insights: Further studies on ATP synthase’s role in stress responses (e.g., drought, high light) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
ATP synthase protein MI25; ORF 25
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Protein Sequence
MRLSSTNMQARKMLFAAILSICASSSKKISIYNEEMIVALCFIGFIIFSWKSLGKTFKVT LDGRIQAIQEESQQFPNPNEVVPPESNEQQRLLRISLRICGTVVESLPMARCAPKCEKTV QALLCRNLNVKSATLPNATSSRRIRLQDDIAIKMHVLVGKRFCPWCSSKAERVEFIRESL VVLRMVWVGDSLKNKELE
Uniprot No.

Target Background

Function

This protein represents one of the chains (CF0 subunit) of the non-enzymatic component of the mitochondrial ATP synthase complex.

Database Links

KEGG: nta:3205236

Protein Families
ATPase protein MI25 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

How does ATP synthase contribute to photosynthetic electron transport in tobacco plants?

ATP synthase plays a critical role in photosynthetic electron transport by utilizing the proton gradient established across the thylakoid membrane. In tobacco plants:

  • ATP synthase utilizes the proton motive force (pmf) to synthesize ATP

  • It works in concert with cytochrome b6f complex to balance ATP and NADPH production

  • The enzyme controls lumen acidification, which regulates photosynthetic control and photoprotective mechanisms

The proton gradient (ΔpH) component of the pmf typically maintains lumen pH between 6.5-7.0 under normal conditions. When this balance is disrupted, photoprotective mechanisms such as nonphotochemical quenching (qN) are activated .

Research methodology: Contributions of ATP synthase to electron transport can be studied through comparative analysis of wild-type and ATP synthase-repressed lines, using techniques such as fluorescence measurements, gas exchange analysis, and spectroscopic determination of photosynthetic complex content .

What expression systems are available for producing recombinant proteins in Nicotiana species?

Several expression systems are available for producing recombinant proteins in Nicotiana species, with varying efficiencies:

  • Viral expression systems:

    • MagnICON system using RNA replication from tobacco mosaic virus (TMV) and potato virus X (PVX)

    • INPACT expression system using DNA replication from geminivirus

  • Co-expression strategies:

    • Virus-induced gene silencing suppressors (P19 from TBSV, P25 from PVX) to prevent post-transcriptional gene silencing

  • Agrobacterium-mediated transformation:

    • Different strains show varying efficiency (EHA105 > GV3101 > LBA4404)

  • Terminator optimization:

    • Combining strong terminators substantially enhances gene expression

    • PinIIT terminator combinations showed up to 7.3-fold higher expression compared to control

Research methodology: When comparing expression systems, researchers should implement factorial experimental designs with appropriate controls, ensuring standardized conditions across all tested varieties. Fluorescent reporter proteins (like tGFP) allow for quantitative assessment of expression levels .

What are the effects of ATP synthase repression on photosynthetic parameters in tobacco?

ATP synthase repression in tobacco has been thoroughly investigated through antisense approaches targeting the nuclear-encoded γ-subunit (AtpC) and through point mutations in the plastid-encoded atpB gene. These studies revealed significant physiological impacts:

ParameterWild-Type SNNatpC1 (Strong Antisense Line)atpC2 (Weak Antisense Line)
Chlorophyll a/b4.00 ± 0.193.46 ± 0.113.92 ± 0.08
Chlorophyll (mg m⁻²)421.3 ± 82.2332.0 ± 73.3460.4 ± 119.6
Leaf absorptance (%)87.7 ± 2.486.4 ± 2.588.8 ± 0.9
Assimilation (μmol CO₂ m⁻² s⁻¹)26.1 ± 3.69.9 ± 2.424.1 ± 1.7
Respiration (μmol CO₂ m⁻² s⁻¹)-1.2 ± 0.5-0.9 ± 0.5-0.9 ± 0.3
Quanta/CO₂12.2 ± 2.015.3 ± 2.213.3 ± 2.3

The major effects of ATP synthase repression include:

  • Increased proton motive force across thylakoid membranes

  • Strong lumen over-acidification

  • Induction of nonphotochemical quenching at very low light intensities

  • Decreased rates of plastoquinol reoxidation at the cytochrome b6f complex

  • Inhibition of linear electron flux

  • Reduced quantum efficiency of CO₂ fixation

Research methodology: Researchers wishing to study ATP synthase repression should consider both antisense approaches for nuclear-encoded subunits and chloroplast transformation for plastid-encoded subunits. Physiological analyses should include spectroscopic determination of photosynthetic complex content, fluorescence measurements, and gas exchange analysis to provide a comprehensive understanding of photosynthetic parameters .

How can geminiviral vectors improve the yield of recombinant ATP synthase protein in tobacco?

Geminiviral vectors significantly enhance recombinant protein production in tobacco through DNA replication mechanisms. Key findings regarding their efficacy include:

  • Replication enhancement: Geminiviral vectors containing TYLCV (Tomato Yellow Leaf Curl Virus) replication components increased tGFP fluorescence intensity by 13.5-fold compared to control constructs .

  • Co-expression advantages: When combined with gene silencing suppressors (P19), geminiviral vectors produced dramatic improvements:

    • Co-infiltration with T-C1 (TYLCV Rep) and P19 increased expression by 16.9-21.7-fold

    • Co-infiltration with T-C123 (TYLCV Rep, TrAP, and REn) and P19 increased expression by 19.5-23.7-fold

  • Terminator synergy: Combining geminiviral vectors with optimized double terminators (particularly PinIIT-RbcST combinations) produced the highest expression levels .

Research methodology: To implement this approach for recombinant ATP synthase production, researchers should construct expression cassettes with the target gene flanked by TYLCV inverted repeats, co-express with P19 silencing suppressor, and utilize optimized double terminators. Comparative analysis against standard expression systems with quantitative fluorescence measurements or ELISA provides robust assessment of expression enhancement .

What strategies can optimize post-translational modifications of recombinant ATP synthase protein?

Post-translational modifications (PTMs) significantly impact ATP synthase function and stability. Based on PTM databases, the most common modifications include:

PTM typePercentage of TotalRelevance to ATP synthase
Phosphorylation60.29%Regulates ATP synthase activity and assembly
Ubiquitination22.78%Controls protein turnover
Acetylation8.40%Affects protein-protein interactions
Methylation2.89%May alter catalytic properties
N-linked Glycosylation1.01%Impacts protein stability

To optimize PTMs in recombinant ATP synthase production:

  • Host selection: Different Nicotiana species exhibit varying PTM machinery efficiency. N. tabacum (cv. I 64) has demonstrated superior capabilities for proper protein modification and folding .

  • Subcellular targeting: Direct recombinant proteins to appropriate compartments using specific signal peptides to access the desired PTM machinery.

  • Co-expression strategies: Introduce genes encoding specific modifying enzymes alongside the target protein to enhance desired modifications.

Research methodology: Researchers should employ a combination of mass spectrometry approaches (LC-MS/MS) for comprehensive PTM mapping, use site-directed mutagenesis to assess the functional significance of specific modifications, and compare PTM profiles between native and recombinant proteins to ensure functional equivalence .

How do different transformation methods affect the production of recombinant ATP synthase protein in tobacco?

Transformation methods significantly impact recombinant protein yields in tobacco systems. Key considerations include:

  • Transient vs. stable transformation:

    • Transient expression shows greater variability between Nicotiana varieties

    • Stable transgenic lines demonstrate more consistent expression levels across varieties

  • Direct vs. indirect methods for hairy root cultures:

    • Indirect methods yield higher protein content compared to direct methods

    • Transformation efficiency varies significantly between approaches

  • Agrobacterium strain selection:

    • Expression efficiency hierarchy: EHA105 > GV3101 > LBA4404

    • Optimal strain selection should be empirically determined for specific recombinant proteins

  • Vector design considerations:

    • Anti-sense approaches against nuclear-encoded subunits (γ-subunit/AtpC)

    • Point mutations in plastid-encoded subunits (β-subunit/atpB) via chloroplast transformation

Research methodology: When evaluating transformation methods, researchers should implement full factorial designs comparing multiple Nicotiana varieties, transformation techniques, and expression vectors simultaneously. Standardized quantification methods (western blotting, ELISA, or fluorescence measurement for tagged proteins) should be used to enable direct comparison of protein yields .

What experimental approaches can elucidate ATP synthase interactions with other photosynthetic machinery components?

Understanding ATP synthase interactions with other components of the photosynthetic apparatus requires sophisticated experimental approaches:

  • Genetic manipulation studies:

    • ATP synthase repression reveals functional relationships with cytochrome b6f complex

    • Mutants with ATP synthase contents ranging from 100% to <10% of wild-type levels show how the proton motive force affects electron transport chain components

  • Spectroscopic analyses:

    • 77K chlorophyll fluorescence emission spectra detect antenna redistribution between photosystems

    • Spectroscopic determination of photosystem content reveals compensatory mechanisms

  • Proteomics approaches:

    • iTRAQ (isobaric tags for relative and absolute quantitation) enables quantitative proteomics to identify co-regulated proteins

    • Two-dimensional electrophoresis followed by mass spectrometry identifies interaction partners

  • Biochemical validation:

    • Co-immunoprecipitation and pull-down assays confirm direct protein-protein interactions

    • Blue native gel electrophoresis assesses supramolecular complex formation

Research methodology: A comprehensive approach should combine genetic manipulation (antisense/knockout lines) with quantitative proteomics and biochemical validation. Researchers should monitor changes in the accumulation of linear electron transport chain components, plastoquinol reoxidation rates, and photosynthetic control parameters to fully characterize ATP synthase interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.