Recombinant Nicotiana tabacum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Overview of ATP Synthase Subunit a (atpI) in Nicotiana tabacum

The chloroplast ATP synthase in tobacco is a multi-subunit complex responsible for converting the proton motive force (pmf) into ATP. Subunit a (encoded by the atpI gene) forms part of the membrane-embedded F0_0 sector, facilitating proton translocation across the thylakoid membrane . The atpI gene resides in the plastid genome and is co-transcribed with atpH, atpF, and atpA as part of the atpI-H-F-A operon . Engineering efforts to modify c-ring stoichiometry in this complex (e.g., altering proton-to-ATP ratios) have highlighted the structural and functional importance of subunit a in maintaining photosynthetic efficiency .

Recombinant Expression and Purification

Recombinant Nicotiana tabacum ATP synthase subunit a is produced in heterologous systems for structural and functional studies. Key details include:

ParameterSpecification
Expression SystemEscherichia coli (common) or yeast
TagN-terminal His tag for affinity purification
Protein LengthFull-length (1–395 amino acids)
Amino Acid SequenceMFRRIFLFDEDSLNSSVTSYTNASQSTTTIMDYSLKSSDTQGSSSGIFTDHPGLNPCSER... (truncated)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Research Applications

  • Biochemical Studies: Recombinant subunit a enables in vitro reconstitution of ATP synthase activity and analysis of proton transport mechanisms .

  • Plant Engineering: Transplastomic tobacco lines with modified atpI sequences (e.g., mimicking cyanobacterial c15_{15}-rings) demonstrate adaptive increases in pmf magnitude to sustain ATP production despite reduced ATP synthase abundance .

  • Pathogen Interaction Studies: ATP synthases, including subunit a, influence microbial virulence. For example, Fusarium oxysporum mutants with disrupted ATP synthase activity show reduced pathogenicity in tobacco .

Challenges in Recombinant Production

  • Structural Stability: Non-native modifications (e.g., c15_{15}-ring substitution) reduce ATP synthase complex stability, as observed in SDS-PAGE degradation patterns .

  • Expression Optimization: Strategies like endoplasmic reticulum (ER)-targeted expression (e.g., using KDEL sequences) enhance recombinant protein stability in tobacco .

Future Directions

Research priorities include elucidating subunit a’s role in pmf modulation under stress and leveraging transient expression systems (e.g., TuMV vectors ) for high-yield production. Comparative studies with N. sylvestris homologs could further clarify evolutionary adaptations in ATP synthase function.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: nta:800497

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a in Nicotiana tabacum chloroplasts?

ATP synthase subunit a (atpI) is an integral membrane protein component of the F0 domain of the chloroplastic ATP synthase complex. In Nicotiana tabacum, this subunit functions as part of the proton channel, facilitating H+ transport through the thylakoid membrane. The protein contains multiple transmembrane segments that form part of the stator structure, which remains stationary while the central rotor turns during ATP synthesis. The ATP synthase complex couples the proton motive force generated by photosynthetic electron transport to ATP synthesis, playing a critical role in energy metabolism in chloroplasts .

The chloroplastic ATP synthase in tobacco consists of both nuclear-encoded and plastid-encoded subunits that must be assembled in a coordinated manner. The atpI gene is part of the plastid-encoded atpI-H-F-A operon, highlighting the complex interplay between nuclear and chloroplast genomes in the biogenesis of this essential complex .

How does the chloroplast ATP synthase interact with other components of the photosynthetic machinery?

Chloroplast ATP synthase in N. tabacum functions as an integral component within the broader photosynthetic apparatus, exhibiting dynamic interactions with other complexes. Research shows that tobacco plants strictly adjust the contents of both ATP synthase and cytochrome b6f complex to match the metabolic demand for ATP and NADPH .

The interaction between these complexes is critical for maintaining optimal photosynthetic efficiency. When ATP synthase activity is reduced, lumen over-acidification occurs, triggering photoprotective mechanisms even under low light conditions. This results in diminished quantum efficiency of CO2 fixation . Additionally, studies demonstrate that mitochondrial function significantly impacts photosynthesis, revealing flexible chloroplast-mitochondrion interactions capable of overcoming lesions in energy metabolism .

What are the key differences between bacterial and plant chloroplastic ATP synthase subunits?

While chloroplast ATP synthase evolved from cyanobacterial ancestors following endosymbiosis, several key differences exist between bacterial and plant chloroplastic ATP synthase subunits:

  • Genetic origin: In plants like N. tabacum, ATP synthase subunits are encoded by both the nuclear and plastid genomes, requiring coordinated expression and assembly, whereas bacterial ATP synthase subunits are encoded in a single genome .

  • Regulatory mechanisms: Plant chloroplastic ATP synthase is subject to light-dependent regulation and redox control mechanisms not present in bacterial systems.

  • Structural adaptations: Plant ATP synthase has evolved specific structural features to function optimally in the thylakoid membrane environment and to respond to the unique requirements of photosynthesis.

  • c-ring composition: The number of c-subunits in the rotor ring can differ between bacterial and plant ATP synthases, affecting the H+/ATP ratio. This has been demonstrated through engineering experiments where the tobacco c-ring was modified to mimic that of the cyanobacterium S. platensis .

What approaches have been successful for expressing and purifying recombinant N. tabacum ATP synthase subunit a?

Successful expression and purification of recombinant N. tabacum ATP synthase subunit a (ATP6) has been achieved using E. coli expression systems. The full-length protein (1-395 amino acids) has been expressed with an N-terminal His-tag for purification purposes .

Protocol overview for expression and purification:

  • Gene cloning: The ATP6 coding sequence is cloned into an expression vector with an N-terminal His-tag.

  • Expression conditions: Transformation into E. coli followed by induction under optimized conditions.

  • Purification: Immobilized metal affinity chromatography (IMAC) utilizing the His-tag.

  • Storage: The purified protein is typically stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

  • Reconstitution: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol added for long-term storage at -20°C/-80°C .

For functional studies, it's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How do mutations in atpI affect ATP synthase assembly and function in N. tabacum?

  • Assembly defects: Mutations in any essential ATP synthase subunit typically result in impaired complex assembly. For instance, mutations in the plastid-encoded atpB gene (encoding the β-subunit) via chloroplast transformation have demonstrated that reduced ATP synthase levels significantly impact photosynthetic performance .

  • Function and photosynthesis correlation: Plants with reduced ATP synthase content exhibit restricted photosynthetic electron transport and increased non-photochemical quenching (NPQ) even at low light intensities, suggesting a critical role for ATP synthase in optimizing photosynthetic efficiency .

  • Relationship with electron transport: Research shows that when ATP synthase activity is too low, lumen over-acidification restricts linear electron flux and initiates photoprotective mechanisms, diminishing the quantum efficiency of CO2 fixation .

  • Compensation mechanisms: Plants may deploy various compensation mechanisms when ATP synthase function is compromised, including adjustments to other components of the photosynthetic apparatus and changes in metabolic pathways.

What is the current understanding of ATP synthase biogenesis coordination between nuclear and chloroplast genomes?

The biogenesis of chloroplast ATP synthase requires precise coordination between nuclear and chloroplast genomes, as exemplified by studies in photosynthetic organisms:

  • Coordinated expression: In N. tabacum, ATP synthase contains subunits encoded by both plastid and nuclear genes, necessitating coordinated expression for proper assembly . This coordination involves complex regulatory networks that ensure stoichiometric production of all subunits.

  • Role of nuclear factors: Nuclear-encoded factors play crucial roles in the expression of chloroplast-encoded ATP synthase subunits. In Chlamydomonas reinhardtii, the nuclear factor MDE1, an octotricopeptide repeat (OPR) protein, is required to stabilize the chloroplast-encoded atpE mRNA . Similar mechanisms likely exist in N. tabacum.

  • Evolutionary implications: The recruitment of nuclear factors like MDE1 for regulating chloroplast gene expression exemplifies the nucleus/chloroplast interplay that evolved after primary endosymbiosis, representing adaptations that occurred approximately 300 million years ago in the ancestor of certain algal clades .

  • Quality control mechanisms: Assembly intermediates and unassembled subunits are typically recognized by quality control systems, including proteases like FTSH1, which plays a role in the concerted accumulation of ATP synthase subunits .

What are the optimal conditions for expressing recombinant N. tabacum ATP synthase subunit a in heterologous systems?

Based on successful expression approaches, the following conditions are recommended for optimal expression of recombinant N. tabacum ATP synthase subunit a:

Expression system selection:
E. coli has proven effective for expressing the full-length ATP6 protein (1-395 amino acids) . BL21(DE3) or similar strains are typically preferred for membrane protein expression.

Expression vector considerations:

  • Include an N-terminal His-tag for purification

  • Use a strong, inducible promoter (T7 or similar)

  • Consider codon optimization for E. coli if expression yield is low

Induction and culture conditions:

  • IPTG concentration: 0.1-0.5 mM

  • Induction temperature: Lower temperatures (16-25°C) often improve folding of membrane proteins

  • Induction duration: Extended periods (overnight) at lower temperatures

  • Media: Enriched media such as Terrific Broth or 2xYT may improve yields

Membrane protein solubilization:

  • Use mild detergents for extraction (DDM, LDAO, or similar)

  • Include glycerol (5-10%) in buffers to stabilize the protein

  • Maintain pH between 7.5-8.0 throughout purification

These parameters should be optimized for each specific expression construct and experimental setup.

How can researchers effectively study the interactions between ATP synthase and other photosynthetic complexes?

Studying interactions between ATP synthase and other photosynthetic complexes requires a multi-faceted approach:

1. Biochemical approaches:

  • Blue-native PAGE (BN-PAGE) to identify stable supercomplex formations

  • Co-immunoprecipitation using antibodies against ATP synthase subunits

  • Cross-linking mass spectrometry to capture transient interactions

  • Gradient centrifugation to separate complexes based on size and shape

2. Biophysical methods:

  • Förster Resonance Energy Transfer (FRET) for in vivo proximity analysis

  • Surface Plasmon Resonance (SPR) to measure binding kinetics

  • Cryo-electron microscopy to visualize supercomplexes in near-native states

3. Genetic approaches:

  • Generation of ATP synthase mutants through chloroplast transformation

  • Analysis of compensatory changes in other complexes when ATP synthase levels are altered

  • Repression of ATP synthase through antisense approaches targeting essential subunits like AtpC (γ-subunit)

4. Physiological measurements:

  • Measurements of proton motive force using fluorescent probes

  • Analysis of photosynthetic electron transport rates using oxygen electrodes

  • Chlorophyll fluorescence to assess non-photochemical quenching and photosystem II efficiency

Research has shown that manipulating ATP synthase levels affects the function of other photosynthetic complexes, highlighting their interdependence .

What techniques are most effective for analyzing ATP synthase activity in isolated chloroplasts?

Several complementary techniques can be employed to effectively analyze ATP synthase activity in isolated chloroplasts:

1. ATP synthesis measurements:

  • Luciferin-luciferase assay for real-time ATP quantification

  • 32P-radiolabeling to track newly synthesized ATP

  • HPLC-based methods for precise ATP/ADP ratio determination

2. Proton gradient assessment:

  • 9-aminoacridine fluorescence quenching to measure ΔpH across the thylakoid membrane

  • Electrochromic shift (ECS) measurements to assess both ΔpH and ΔΨ components

  • pH-sensitive fluorescent proteins for in vivo studies

3. Functional enzyme assays:

  • ATPase activity measurement (hydrolysis direction) using phosphate release assays

  • Coupling factor reconstitution into liposomes to assess proton pumping

  • Patch-clamp techniques for direct measurement of proton currents

4. Structural integrity assessment:

  • Antibody-based quantification of ATP synthase subunits via immunoblotting

  • BN-PAGE to assess complex assembly and integrity

  • Proteomic analysis to determine stoichiometry of subunits

Data interpretation considerations:

  • Compare ATP synthase activity with electron transport rates to assess coupling efficiency

  • Consider the effects of light intensity and quality on activity measurements

  • Account for potential damage during chloroplast isolation

How should researchers design experiments to study the effects of environmental stress on ATP synthase function in N. tabacum?

When designing experiments to study environmental stress effects on ATP synthase function in N. tabacum, consider this structured approach:

Experimental design framework:

  • Control and stress conditions selection:

    • Define precise stress parameters (temperature range, light intensity, drought severity)

    • Include appropriate controls and recovery treatments

    • Consider both acute and chronic stress exposures

  • Measurement timeline:

    • Establish baseline measurements before stress application

    • Include multiple time points during stress exposure

    • Monitor recovery phase after stress removal

  • Multi-level analysis approach:

    Analysis LevelTechniquesParameters
    TranscriptionalqRT-PCR, RNA-SeqExpression of atpI and other ATP synthase genes
    TranslationalPolysome profiling, Ribosome footprintingTranslation efficiency of ATP synthase transcripts
    ProteinWestern blotting, proteomicsATP synthase subunit abundance and modifications
    Complex assemblyBN-PAGE, sucrose gradientsIntegrity and stoichiometry of ATP synthase complex
    FunctionalATP synthesis assays, ΔpH measurementsATP production capacity, proton conductivity
    PhysiologicalGas exchange, chlorophyll fluorescencePhotosynthetic efficiency, NPQ responses
  • Comparative analysis:

    • Compare different N. tabacum cultivars or ecotypes

    • Consider transgenic lines with altered ATP synthase levels

    • Include other species for evolutionary perspective

Research has shown that ATP synthase activity in tobacco adjusts to metabolic demands under different conditions, making it an excellent model for studying stress responses .

What are the key considerations when interpreting proteomics data related to ATP synthase in plant systems?

When interpreting proteomics data related to ATP synthase in plant systems, researchers should consider several critical factors:

1. Sample preparation considerations:

  • Membrane protein enrichment techniques may bias relative abundance estimates

  • Extraction methods can differentially solubilize various ATP synthase subunits

  • Post-translational modifications may be lost during processing

2. Data normalization and quantification:

  • Use multiple normalization approaches to validate findings

  • Consider both absolute quantification (using standards) and relative quantification

  • Evaluate stoichiometry changes among ATP synthase subunits

3. Context-specific interpretations:

  • Compare ATP synthase subunit changes with those of other photosynthetic complexes

  • Consider developmental stage and tissue-specific expression patterns

  • Analyze time-course data to identify sequential changes in complex assembly

4. Integration with other data types:

  • Correlate protein changes with transcript levels to identify post-transcriptional regulation

  • Link proteomics data with functional measurements of ATP synthase activity

  • Use structural information to interpret the impact of subunit abundance changes

5. Validation approaches:

  • Confirm key findings with targeted methods (western blots, SRM/MRM)

  • Use genetic approaches (mutants, RNAi) to verify functional significance

  • Perform in vitro reconstitution experiments to test hypotheses

For example, proteomics studies in N. tabacum have revealed differential regulation of ATP synthase subunits following treatment with defence-inducing compounds, highlighting the importance of considering the broader cellular context when interpreting data .

What statistical approaches are most appropriate for analyzing differences in ATP synthase activity between wild-type and transgenic N. tabacum plants?

When analyzing differences in ATP synthase activity between wild-type and transgenic N. tabacum plants, appropriate statistical approaches are essential:

1. Experimental design for statistical robustness:

  • Use sufficient biological replicates (minimum n=5 per genotype)

  • Include technical replicates to assess measurement variability

  • Consider blocking designs to account for environmental variation

  • Include multiple independent transgenic lines when possible

2. Preliminary data analysis:

  • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

  • Assess homogeneity of variance using Levene's test

  • Consider data transformations (log, square root) if assumptions are violated

  • Identify and handle outliers appropriately

3. Statistical tests for comparing groups:

Statistical ApproachAppropriate Use CaseAdvantages
Student's t-testComparing two groups (WT vs. single transgenic line)Simple, powerful for normal data
ANOVA with post-hoc testsMultiple transgenic lines or treatmentsControls family-wise error rate
Mixed modelsRepeated measures or hierarchical designsAccounts for random effects
Non-parametric testsNon-normal data distributionRobust to assumption violations
ANCOVAControlling for covariates (e.g., plant size)Reduces unexplained variance

4. Advanced analytical approaches:

  • Regression analysis for dose-response relationships in knockdown lines

  • Principal component analysis to examine relationships among multiple variables

  • Machine learning approaches for complex patterns in multi-parameter datasets

5. Effect size reporting:

  • Include measures of effect size (Cohen's d, η²) in addition to p-values

  • Report confidence intervals to indicate precision of estimates

  • Consider minimum biologically significant differences

Studies examining ATP synthase mutants in tobacco have benefited from rigorous statistical analysis to detect subtle but physiologically significant differences in photosynthetic parameters .

How are new genetic tools advancing our understanding of ATP synthase regulation in N. tabacum?

Recent advances in genetic tools have significantly enhanced our understanding of ATP synthase regulation in N. tabacum:

1. Chloroplast transformation technology:
The ability to precisely edit the plastid genome has allowed researchers to introduce targeted mutations into plastid-encoded ATP synthase genes. For example, engineering the ATP synthase rotor ring by modifying the atpH gene has provided insights into the structure-function relationship of the complex . These approaches have demonstrated that:

2. Nuclear genome editing:
CRISPR-Cas9 technology has been adapted for tobacco, enabling precise manipulation of nuclear-encoded ATP synthase subunits and regulatory factors. This approach complements chloroplast transformation for studying the coordinated biogenesis of ATP synthase.

3. Inducible gene expression systems:
Advances in chemically inducible promoters for both nuclear and plastid genes allow temporal control of ATP synthase component expression, facilitating studies of assembly dynamics and regulatory networks.

4. Reporter gene fusions:
Fluorescent protein fusions with ATP synthase subunits enable real-time visualization of complex assembly and localization, revealing dynamic aspects of regulation not accessible through biochemical approaches alone.

These genetic tools have revealed that the chloroplast ATP synthase in tobacco is tightly regulated at multiple levels, from transcription and translation to assembly and activity modulation .

What are the implications of ATP synthase research in N. tabacum for improving crop photosynthetic efficiency?

ATP synthase research in N. tabacum has significant implications for improving crop photosynthetic efficiency:

1. Fine-tuning proton motive force:
Research has demonstrated that ATP synthase activity must be precisely adjusted to linear electron flux for optimal photosynthesis. When ATP synthase activity is too low, lumen overacidification restricts electron transport and triggers photoprotective mechanisms even in low light, reducing CO2 fixation efficiency . This understanding suggests strategies for optimizing proton motive force through targeted modifications of ATP synthase.

2. Engineering ATP/NADPH ratio:
By modifying ATP synthase components, researchers can potentially alter the ATP/NADPH ratio produced during photosynthesis to better match the requirements of carbon fixation under different environmental conditions.

3. Stress tolerance improvement:
Studies on the flexibility of metabolic interactions between chloroplasts and mitochondria in N. tabacum reveal adaptive mechanisms that can overcome lesions in energy metabolism . These insights could lead to strategies for enhancing crop resilience to environmental stresses that affect energy metabolism.

4. Photosynthetic optimization targets:
ATP synthase properties affect several key parameters that could be targets for crop improvement:

  • The balance between photochemical and non-photochemical quenching

  • The regulation of electron transport rates

  • The coordination between light and dark reactions of photosynthesis

  • The energy cost of carbon fixation

What are the emerging areas of research concerning ATP synthase structure and function in N. tabacum?

Several exciting emerging areas are advancing our understanding of ATP synthase structure and function in N. tabacum:

1. High-resolution structural studies:
Recent advances in cryo-electron microscopy and X-ray crystallography are enabling more detailed structural characterization of plant ATP synthases. These studies are revealing species-specific features of N. tabacum ATP synthase that influence its function in the unique environment of the thylakoid membrane.

2. Dynamic regulation mechanisms:
Emerging research is focusing on how ATP synthase activity is modulated in response to changing environmental conditions. This includes:

  • Redox regulation of ATP synthase subunits

  • Post-translational modifications affecting enzyme kinetics

  • Thylakoid membrane organization and lateral heterogeneity

  • Association with other complexes in dynamic supercomplexes

3. Biogenesis and assembly pathways:
Studies like those in Chlamydomonas reinhardtii are revealing sophisticated mechanisms for coordinating the expression of nuclear and chloroplast genes encoding ATP synthase subunits . Similar work in N. tabacum is uncovering species-specific assembly factors and chaperones.

4. Systems biology approaches:
Integration of transcriptomics, proteomics, and metabolomics data is providing a comprehensive view of how ATP synthase functions within the broader context of plant metabolism. For example, proteome analysis of N. tabacum cells has revealed complex networks of proteins that respond collectively to environmental stimuli .

5. Synthetic biology applications:
Researchers are exploring the potential for engineering modified ATP synthases with altered properties, such as different H+/ATP ratios or regulatory characteristics. The successful engineering of the tobacco ATP synthase rotor ring demonstrates the feasibility of this approach .

These emerging areas highlight the continued importance of N. tabacum as a model system for understanding fundamental aspects of bioenergetics and photosynthesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.