Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 16, chloroplastic (CAB16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Synonyms
CAB16; Chlorophyll a-b binding protein 16, chloroplastic; LHCII type I CAB-16; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-266
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
CAB16
Target Protein Sequence
RKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links

KEGG: nta:107764358

UniGene: Nta.3519

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the optimal Nicotiana tabacum cultivar for recombinant CAB16 expression?

Based on comparative analysis across 52 Nicotiana varieties, Nicotiana tabacum (cv. I 64) has demonstrated superior capacity for recombinant protein expression. This cultivar produces the highest transient concentrations of recombinant proteins while offering additional advantages including substantial biomass production and relatively low alkaloid content, making it particularly suitable for recombinant CAB16 expression systems . When establishing a new CAB16 expression system, researchers should consider:

For most research applications, initiating work with N. tabacum (cv. I 64) provides the greatest probability of successful recombinant CAB16 expression.

What growth conditions are recommended for Nicotiana tabacum suspension cultures when expressing recombinant CAB16?

Optimal growth conditions for N. tabacum suspension cultures, such as the widely used BY-2 cell line, include incubation in the dark at 25°C with continuous agitation (90 rpm) in liquid MS medium . For successful CAB16 expression, the medium composition should include:

  • 4.4 g/L Murashige and Skoog salts

  • 30 g/L sucrose

  • 0.2 g/L KH₂PO₄

  • 2.5 mg/L thiamine

  • 50 mg/ml myo-inositol

  • 0.2 mg/L 2,4-D

  • pH adjusted to 5.8 with KOH

Cultures should be maintained in 50 mL medium (in 250-mL Erlenmeyer flasks) with 5% inoculum transferred weekly to fresh medium. For transformed cells carrying recombinant CAB16 constructs, solid medium supplemented with appropriate selection markers (e.g., 20 μg/mL bialaphos for bar gene selection) should be used .

How does the expression of CAB16 differ between transient and stable transformation systems in Nicotiana?

Significant differences exist between transient and stable expression systems for recombinant proteins like CAB16 in Nicotiana hosts. Transient expression levels vary substantially among different Nicotiana varieties, with N. tabacum (cv. I 64) consistently showing the highest expression levels . In contrast, when stable transgenic plants are developed, the variety of Nicotiana has minimal practical impact on recombinant protein concentration .

The key considerations for each system include:

Transient Expression:

  • Provides rapid results (typically within days)

  • Shows high variability between cultivars

  • Enables quick screening of construct designs

  • Useful for proof-of-concept studies and protein function analyses

Stable Expression:

  • Offers consistent protein production across generations

  • Shows less variability between cultivars

  • Provides sustainable, long-term protein production

  • Better suited for detailed protein characterization studies and applications requiring consistent yields

Researchers should select the appropriate system based on their specific experimental objectives for CAB16 study.

What strategies can be employed for CRISPR-Cas9-mediated modification of CAB16 in Nicotiana tabacum?

For precise genetic modification of CAB16 in N. tabacum, the CRISPR-Cas9 system offers a powerful approach. Based on successful gene editing in N. tabacum BY-2 cells, a comprehensive strategy should include:

  • sgRNA Design: Target specific regions of the CAB16 gene, ideally with restriction sites to facilitate identification of mutations through RFLP analysis. For complex modifications, multiple sgRNAs can be employed simultaneously (up to three have been successfully used) .

  • Vector Construction: Utilize a binary vector containing:

    • Codon-optimized Cas9 (e.g., Arabidopsis codon-optimized version) under a strong promoter (e.g., 35S-PPDK)

    • sgRNAs driven by the U6 promoter

    • Selection marker (e.g., bar gene for bialaphos resistance)

  • Transformation Method: Transform N. tabacum cells via Agrobacterium tumefaciens-mediated transformation, using strains like LBA4404virG .

  • Validation of Editing: Implement a multi-step validation process:

    • PCR amplification of the target region

    • RFLP analysis to detect INDELs

    • Sequencing of PCR fragments to characterize the exact mutations

When targeting multiple sites simultaneously, anticipate both small INDELs at individual target sites and larger deletions between target sites, which can occur when breaks happen at two sites simultaneously .

How can phenotypic effects of CAB16 modifications be effectively assessed in transformed Nicotiana tabacum?

Comprehensive assessment of phenotypic effects following CAB16 modification requires a multi-faceted approach:

  • Fluorescence Analysis: If working with a fluorescent reporter system (similar to the mCherry system described for BY-2 cells), fluorescence intensity can be quantitatively measured to assess functional impact . For CAB16, changes in chlorophyll fluorescence measurements would be particularly relevant.

  • Protein Expression Quantification: Analyze total soluble protein levels and specifically quantify CAB16 protein using techniques such as:

    • Western blotting with CAB16-specific antibodies

    • ELISA for protein quantification

    • Mass spectrometry for detailed protein characterization

  • Physiological Parameters:

    • Measure growth rates and biomass accumulation

    • Analyze photosynthetic efficiency (e.g., through chlorophyll fluorescence parameters)

    • Assess plant response to various light conditions

  • Molecular Characterization:

    • RT-PCR to confirm expression of modified genes

    • DNA sequencing to verify genetic modifications

    • Analysis of downstream gene expression changes

  • Comparative Studies: Always include appropriate controls:

    • Wild-type plants

    • Plants transformed with empty vectors

    • Plants expressing unmodified CAB16

This comprehensive approach enables researchers to correlate genetic modifications with specific functional outcomes in the photosynthetic apparatus.

What are the critical factors affecting the stability of recombinant CAB16 in Nicotiana expression systems?

Several factors significantly influence the stability of recombinant CAB16 expression in Nicotiana systems:

  • Integration Site Effects: The chromosomal location of transgene integration affects expression stability, with some positions resulting in variegated expression or silencing over generations. Position effects are more relevant in stable transformation systems compared to transient expression .

  • Copy Number Variation: Multiple transgene copies often lead to co-suppression and silencing rather than increased expression. Single-copy integrations typically provide more stable expression patterns.

  • Promoter Selection: The choice of promoter significantly impacts expression stability:

    Promoter TypeExpression LevelStabilityTissue Specificity
    Constitutive (e.g., 35S)HighModerateLow
    InducibleControllableHighDepends on system
    Tissue-specificVariableHigh in target tissueHigh
  • Post-translational Modifications: For chloroplastic proteins like CAB16, proper targeting to the chloroplast and correct folding are essential. Inclusion of chloroplast transit peptides and optimization of codon usage for chloroplast expression can enhance stability.

  • Proteolytic Activity: BY-2 cells and other Nicotiana hosts may contain proteases that degrade recombinant proteins. Strategies to minimize proteolytic degradation include co-expression of protease inhibitors or secretion of the protein to the apoplastic space .

  • Culture Conditions: For suspension cultures, maintaining optimal growth conditions as described in previous sections is critical for stable protein expression.

What extraction and purification protocols yield optimal recovery of functional recombinant CAB16?

Efficient extraction and purification of recombinant CAB16 from Nicotiana requires protocols optimized for chloroplastic membrane proteins:

  • Sample Collection:

    • For suspension cultures: Harvest cells during logarithmic growth phase (typically 3-4 days after subculture)

    • For whole plants: Collect young, fully expanded leaves (typically 100 mg tissue)

  • Cell Disruption:

    • Homogenize tissue in extraction buffer containing:

      • 50 mM Tris-HCl, pH 7.5

      • 150 mM NaCl

      • 1 mM EDTA

      • 10% glycerol

      • Protease inhibitor cocktail

      • Mild detergents (e.g., 0.5-1% Triton X-100 or n-dodecyl-β-D-maltoside)

  • Differential Centrifugation:

    • Low-speed centrifugation (1,000g, 10 min) to remove cellular debris

    • High-speed centrifugation (10,000g, 20 min) to isolate chloroplasts

    • Membrane solubilization using appropriate detergents

    • Ultracentrifugation (100,000g, 1 hour) to separate solubilized proteins

  • Affinity Chromatography:

    • If using tagged recombinant CAB16, employ appropriate affinity matrices

    • For untagged proteins, consider immunoaffinity chromatography using anti-CAB16 antibodies

  • Quality Assessment:

    • SDS-PAGE for purity evaluation

    • Western blotting for identity confirmation

    • Spectrophotometric analysis for chlorophyll binding capacity

    • Circular dichroism for secondary structure confirmation

Throughout all purification steps, maintain low temperature (4°C) and protect samples from strong light to minimize protein degradation and chlorophyll photodamage.

How can researchers effectively troubleshoot low expression levels of recombinant CAB16?

When encountering low expression levels of recombinant CAB16, systematic troubleshooting should address:

  • Vector Design Issues:

    • Verify promoter functionality using reporter genes

    • Confirm codon optimization for Nicotiana tabacum

    • Ensure proper inclusion of chloroplast transit peptide

    • Check for unexpected recombination events by sequencing

  • Transformation Efficiency:

    • Evaluate Agrobacterium strain compatibility with your Nicotiana variety

    • Optimize co-cultivation conditions (duration, temperature, bacterial density)

    • Assess selection marker efficiency

    • Consider alternative transformation methods

  • Post-translational Limitations:

    • Investigate protein stability using pulse-chase experiments

    • Analyze for proteolytic degradation using protease inhibitors

    • Examine chloroplast targeting efficiency using subcellular fractionation

    • Consider co-expression with molecular chaperones to improve folding

  • Expression Silencing:

    • Check for transcriptional silencing using RT-PCR

    • Evaluate DNA methylation status in the promoter region

    • Consider using viral suppressors of gene silencing

    • Test different genomic locations using site-specific integration systems

  • Experimental Protocol Modifications:

    • Adjust growth conditions (light intensity, photoperiod for whole plants)

    • Modify media composition (nitrogen source, micronutrients)

    • Optimize harvest timing to coincide with peak expression

    • Test different extraction buffers and conditions

A methodical approach to each of these areas will help identify the specific bottlenecks limiting recombinant CAB16 expression.

What analytical methods are most appropriate for characterizing the functional properties of recombinant CAB16?

Comprehensive characterization of recombinant CAB16 requires multiple analytical approaches:

  • Spectroscopic Analysis:

    • Absorption spectroscopy (350-750 nm) to confirm chlorophyll binding

    • Fluorescence emission spectroscopy to assess energy transfer capabilities

    • Circular dichroism to analyze secondary structure elements

    • Resonance Raman spectroscopy for pigment-protein interactions

  • Binding Assays:

    • Isothermal titration calorimetry for chlorophyll binding kinetics

    • Fluorescence quenching assays to determine binding affinities

    • Size exclusion chromatography to assess complex formation

  • Structural Studies:

    • X-ray crystallography for high-resolution structural analysis

    • Cryo-electron microscopy for protein complex visualization

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural information

  • Functional Assays:

    Assay TypeParameter MeasuredMethodologyExpected Result for Functional CAB16
    Energy transferExcitation energy transfer efficiencyTime-resolved fluorescenceHigh efficiency (>80%)
    Thermal stabilityProtein denaturation temperatureDifferential scanning calorimetryHigher Tm with bound chlorophyll
    Photosynthetic activityElectron transport rateOxygen evolution measurementsEnhanced rates in reconstituted systems
    PhotoprotectionNon-photochemical quenchingPulse-amplitude modulation fluorometryIncreased NPQ capacity
  • Comparative Analysis:

    • Parallel characterization of native and recombinant CAB16

    • Analysis of CAB16 variants with specific mutations

    • Comparison across different expression systems

These analytical methods provide complementary information about the structural integrity and functional capacity of recombinant CAB16, enabling comprehensive assessment of its biological activity.

How should researchers interpret differences in CAB16 expression patterns between transient and stable transformation systems?

When analyzing differences in CAB16 expression between transient and stable systems, consider these interpretive frameworks:

  • Temporal Expression Dynamics:

    • Transient expression typically peaks 3-5 days post-infiltration and then declines, representing a snapshot of expression capacity

    • Stable expression should be evaluated across multiple generations to assess long-term stability and inheritance patterns

    • Differential expression patterns may reflect distinct regulatory mechanisms rather than system limitations

  • Cellular Localization Considerations:

    • For chloroplastic proteins like CAB16, stable transformation may allow more complete chloroplast development and maturation

    • Transient systems may show incomplete or variable chloroplast targeting efficiency

    • Use confocal microscopy with appropriate fluorescent tags to visualize localization differences

  • Statistical Approach:

    • Account for the inherently higher variability in transient systems

    • Use appropriate statistical tests (e.g., nested ANOVA) to separate variability due to the expression system from other experimental factors

    • Report both mean expression levels and measures of variability (standard deviation, coefficient of variation)

  • Relationship to Experimental Goals:

    • Preliminary characterization and functional studies may be adequately served by transient expression

    • Detailed structure-function relationships and physiological studies typically require stable transformation systems

    • Consider transient expression results as indicative but not definitive of expected stable expression outcomes

Researchers should view these systems as complementary rather than competitive approaches, each offering distinct advantages for specific research questions about CAB16 function and regulation.

What statistical approaches are most appropriate for analyzing variability in CAB16 expression across different Nicotiana varieties?

The appropriate statistical framework for analyzing CAB16 expression variability should account for multiple sources of variation:

How can CRISPR-Cas9 genome editing be optimized for studying CAB16 function in photosystem II assembly?

Optimizing CRISPR-Cas9 for functional studies of CAB16 in photosystem II assembly requires a targeted experimental design:

  • Precise Editing Strategy:

    • Design sgRNAs targeting specific functional domains of CAB16

    • Create a panel of mutations including:

      • Complete gene knockout

      • Targeted modifications of chlorophyll-binding residues

      • Alterations to protein-protein interaction domains

    • Use multiple sgRNAs simultaneously for creating larger deletions when needed

  • Vector Design Optimization:

    • Employ plant codon-optimized Cas9 (e.g., Arabidopsis-optimized version)

    • Use strong, ideally inducible promoters for Cas9 expression

    • Include appropriate selection markers (e.g., bar gene for bialaphos resistance)

    • Consider including visual markers to facilitate screening

  • Validation Framework:

    • Implement comprehensive validation using:

      • PCR amplification to detect large deletions

      • RFLP analysis for identifying small INDELs

      • DNA sequencing to characterize precise modifications

      • RT-PCR to confirm changes in expression patterns

  • Functional Assessment:

    • Analyze photosystem II assembly using:

      • Blue-native PAGE for protein complex integrity

      • Pulse-amplitude modulation fluorometry for photosystem II function

      • Electron microscopy for structural analysis

      • Photosynthetic performance measurements

  • Quantitative Phenotyping:

    • Implement high-throughput phenotyping approaches

    • Measure multiple parameters simultaneously

    • Use machine learning algorithms for pattern recognition in complex datasets

This integrated approach enables systematic dissection of CAB16 functional roles in photosystem II assembly through precisely engineered mutations.

What experimental approaches can reliably distinguish between direct and indirect effects of CAB16 modifications on photosynthetic efficiency?

Distinguishing direct from indirect effects of CAB16 modifications requires a multi-layered experimental design:

  • Time-Resolved Analysis:

    • Monitor changes in photosynthetic parameters at multiple time points after CAB16 modification

    • Primary (direct) effects typically manifest earlier than secondary (indirect) effects

    • Use inducible expression/suppression systems to establish temporal relationships

  • Dose-Response Relationships:

    • Create a series of CAB16 variants with graduated expression levels

    • Plot photosynthetic parameters against CAB16 abundance

    • Direct effects typically show linear or saturable relationships with protein levels

  • Protein-Protein Interaction Studies:

    • Use techniques like:

      • Bimolecular fluorescence complementation

      • Co-immunoprecipitation

      • Förster resonance energy transfer

    • Map the interaction network of CAB16 with other photosystem components

  • In vitro Reconstitution:

    • Reconstitute minimal functional units with purified components

    • Systematically add/remove components to identify direct dependencies

    • Compare with in vivo results to distinguish system-level effects

  • Compensatory Mutations:

    • Introduce secondary mutations designed to rescue specific CAB16 functions

    • Partial recovery of phenotypes can reveal mechanistic relationships

  • Control Experiments:

    • Include parallel modifications of related proteins (other CAB family members)

    • Compare phenotypic signatures to identify CAB16-specific effects

This comprehensive approach allows researchers to build a causal model distinguishing direct functional roles of CAB16 from downstream consequences of its modification.

How can researchers effectively integrate transcriptomic, proteomic, and metabolomic data to comprehensively characterize CAB16 function in Nicotiana tabacum?

Effective multi-omics integration for CAB16 functional characterization requires a systematic framework:

  • Experimental Design Considerations:

    • Collect samples from the same biological material for all omics analyses

    • Include appropriate time-series sampling to capture dynamic responses

    • Maintain consistent environmental conditions to minimize confounding variables

    • Include both wild-type and multiple CAB16 variant lines

  • Data Processing and Normalization:

    • Standardize processing workflows across experiments

    • Apply appropriate normalization methods for each data type

    • Implement batch effect correction for samples processed at different times

    • Develop quality control metrics specific to each data type

  • Integration Methods:

    Integration ApproachSuitable ForKey AdvantagesComputational Requirements
    Network analysisAll omics typesReveals regulatory relationshipsHigh
    Multivariate statistical methods (PCA, OPLS-DA)All omics typesIdentifies patterns and separationsModerate
    Pathway enrichment analysisAll omics typesConnects to biological functionsModerate
    Bayesian integrationAll omics typesAccounts for uncertainty and prior knowledgeVery high
    Machine learning approachesLarge datasetsCan detect non-linear relationshipsHigh
  • Biological Interpretation Strategies:

    • Start with pathway-level analysis of photosynthesis-related processes

    • Identify co-regulated networks across different omics layers

    • Focus on temporal relationships to establish causal connections

    • Compare results with published data on CAB proteins in other systems

    • Validate key findings with targeted experimental approaches

  • Visualization and Communication:

    • Develop multi-layered visualizations showing relationships across omics datasets

    • Create accessible data repositories for the scientific community

    • Provide comprehensive methodological details to ensure reproducibility

This integrated multi-omics approach provides unprecedented insights into the functional role of CAB16 in photosynthetic processes and its broader impacts on plant physiology.

What are the most promising future directions for CAB16 research in Nicotiana tabacum expression systems?

The most promising research directions for CAB16 in Nicotiana tabacum include:

  • Advanced Genome Editing Applications: Further refinement of CRISPR-Cas9 approaches for precise modification of CAB16, including base editing and prime editing technologies that offer greater precision than traditional CRISPR-Cas9 systems .

  • Synthetic Biology Approaches: Engineering of novel CAB16 variants with enhanced properties or expanded functionalities, potentially improving photosynthetic efficiency or stress tolerance.

  • Systems Biology Integration: Comprehensive multi-omics studies combining genomics, transcriptomics, proteomics, and metabolomics to fully characterize the regulatory networks and metabolic pathways influenced by CAB16.

  • Structural Biology Advances: High-resolution structural studies of recombinant CAB16 and its interactions with other components of the photosynthetic apparatus, potentially leading to mechanistic insights into energy transfer and photoprotection.

  • Translational Applications: Development of Nicotiana tabacum lines with optimized CAB16 variants for improved photosynthetic efficiency, potentially contributing to crop improvement strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.