Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 21, chloroplastic (CAB21)

Shipped with Ice Packs
In Stock

Description

Introduction to CAB21

Recombinant Chlorophyll a-b binding protein 21 (CAB21), a chloroplastic protein from Nicotiana tabacum (common tobacco), is a critical component of the light-harvesting complex (LHC) in photosynthesis. It belongs to the LHC protein family, which facilitates light energy capture and transfer to photosystems I and II (PSI and PSII) . CAB21 is characterized by its role in stabilizing chlorophyll a and b pigments, enabling efficient excitation energy transfer in the photosynthetic apparatus. The recombinant form is produced in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for structural and functional studies .

Protein Structure

CAB21 is a 265-amino-acid protein with a predicted molecular weight of ~30 kDa (estimated based on sequence length). It contains four transmembrane α-helical domains, typical of LHC proteins, which anchor it in the thylakoid membrane. Its N-terminal domain is disordered, while the C-terminal region binds chlorophyll a and b pigments .

Functional Role

  • Light Harvesting: CAB21 captures photons and transfers excitation energy to PSII and PSI, enhancing photosynthetic efficiency .

  • Stabilization of Pigments: Binds chlorophyll a and b, preventing photobleaching and maintaining structural integrity of the LHC .

Production Methods and Recombinant Forms

Recombinant CAB21 is produced via heterologous expression systems:

ParameterDetailsSource
Host OrganismsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE validated)
TagsN-terminal or C-terminal tags (e.g., His-tag, GST-tag)
ApplicationsStructural biology, photosynthesis research, pigment-binding assays

Interaction Partners and Network Analysis

CAB21 interacts with core components of the photosynthetic machinery, as identified through bioinformatics and interaction databases (STRING v11.5) :

Interaction PartnerFunctionInteraction Score
psbA (Photosystem II D1)Core subunit of PSII; binds P680 (primary electron donor)0.901
psbB (PSII CP47)Stabilizes chlorophyll in PSII core complex0.888
psbC (PSII CP43)Binds chlorophyll and transfers excitation energy0.880
psaB (PSI P700)PSI core subunit; binds chlorophyll a0.852

Key Observations:

  • CAB21 exhibits strong associations with PSII components (e.g., psbA, psbB), suggesting a role in PSII-LHC supercomplex formation .

  • Weak interaction with PSI subunits (e.g., psaN) indicates a primary focus on PSII-mediated light harvesting .

Research Gaps and Future Directions

While CAB21’s role in LHC is well-documented, critical gaps remain:

  1. Structural Dynamics: Limited 3D structural data for CAB21 in chlorophyll-bound states.

  2. Functional Specificity: Mechanisms of energy transfer to PSII vs. PSI require further elucidation.

  3. Post-Translational Modifications: Potential phosphorylation or acetylation sites unexplored.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your application.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
CAB21; Chlorophyll a-b binding protein 21, chloroplastic; LHCII type I CAB-21; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-265
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
CAB21
Target Protein Sequence
RKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNR ELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIK NGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) serves as a light receptor, capturing and transferring excitation energy to the associated photosystems.

Database Links

KEGG: nta:107775016

UniGene: Nta.2705

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Chlorophyll a-b binding protein 21 in Nicotiana tabacum?

Chlorophyll a-b binding protein 21 in Nicotiana tabacum functions as a key component of the photosystem II (PSII) light-harvesting complex. Similar to other CAB proteins, it serves as an antenna protein that captures light energy and transfers it to the reaction center of the photosystem. Based on studies with homologous proteins, CAB21 likely belongs to the external antenna proteins of PSII, similar to LHCb2 proteins, as seen in other plant species . The protein contains binding sites for both chlorophyll-a and chlorophyll-b molecules, which are essential for efficient light absorption during photosynthesis. CAB proteins also play critical roles in photoprotection and energy dissipation mechanisms when plants experience excess light conditions. The presence of multiple functional domains and modifiable sites suggests that CAB21 may be a target for physiological regulation in response to environmental changes .

How is CAB21 targeted to the chloroplast?

CAB21 contains an N-terminal chloroplast transit peptide (cTP) that directs the protein to the chloroplast. This targeting sequence is recognized by the chloroplast import machinery, facilitating the translocation of the protein from its site of synthesis in the cytosol to its final destination in the chloroplast. The transit peptide is typically cleaved by stromal processing peptidase during or after translocation into the chloroplast . The targeting efficiency depends on several factors, including the amino acid composition and structure of the transit peptide. In experimental studies of cTP-GFP fusion proteins, researchers have observed significant variations in targeting efficiency among different cTPs, with some showing higher chloroplast-targeting capabilities than reference cTPs like AtRbcS1A . The localization of CAB21 can be verified experimentally through fluorescence tracking of cTP-GFP fusion proteins using confocal laser-scanning microscopy (CLSM) and confirmed by immunoblotting analysis of isolated chloroplast fractions .

What experimental techniques are used to study CAB21 gene expression?

Several experimental techniques are commonly employed to study CAB21 gene expression:

  • Quantitative Real-Time PCR (qRT-PCR): This technique allows for precise quantification of CAB21 transcript levels under different experimental conditions or stress treatments. qRT-PCR can be used to monitor expression changes over time and across different tissues .

  • RNA-Seq and Transcriptome Analysis: These approaches provide comprehensive insights into the expression patterns of CAB21 alongside other genes in the genome, enabling researchers to identify co-expressed genes and regulatory networks .

  • Promoter Analysis: By fusing the CAB21 promoter region to reporter genes like GFP or GUS, researchers can study the spatial and temporal patterns of gene expression in planta.

  • Northern Blotting: Although less commonly used now, this technique can still be valuable for validating expression findings, especially when examining transcript size variations.

When designing expression studies, it is critical to include appropriate reference genes for normalization and to consider the timing of sample collection, as CAB gene expression often follows diurnal patterns. Based on studies with homologous CAB genes, expression can vary significantly in response to different stresses, making it an interesting subject for environmental response studies .

How can chloroplast transit peptides be optimized for efficient targeting of recombinant CAB21?

Optimizing chloroplast transit peptides (cTPs) for efficient targeting of recombinant CAB21 requires a multi-faceted approach:

  • Comparative Analysis of Natural cTPs: First, conduct a comparative analysis of various natural cTPs to identify high-efficiency candidates. Studies have demonstrated significant variations in chloroplast-targeting efficiency among different cTPs, with some showing superior performance compared to commonly used cTPs like AtRbcS1A . For instance, some cTPs from the cluster A group have demonstrated up to 2-3 fold higher targeting efficiency in experimental systems .

  • Structure-Function Analysis: Perform systematic mutagenesis of the cTP sequence to identify critical regions and amino acid residues that affect targeting efficiency. Pay particular attention to:

    • The N-terminal region (first 10-15 amino acids)

    • The central region containing hydroxylated amino acids

    • The C-terminal region with potential stromal processing peptidase recognition sites

  • Cleavage Site Optimization: Ensure the presence of a predictable and efficient cleavage site, as nonspecific cleavage by bacterial and plant peptidases can affect the specificity and import efficiency of the cTP .

  • In Vitro Import Assays: Use isolated chloroplasts to perform time-course in vitro import assays with different cTP-CAB21 constructs. This allows for direct comparison of import efficiencies under controlled conditions and assessment of precursor to mature protein conversion rates .

  • In Vivo Tracking: Express cTP-fluorescent protein fusions in tobacco leaves via agroinfiltration and quantify chloroplast localization using confocal microscopy. The ratio of chloroplast-localized fluorescence to total cellular fluorescence provides a measure of targeting efficiency .

  • Temporal Analysis: Conduct time-course expression studies (24-96 hours after infiltration) to determine the optimal time window for efficient chloroplast targeting, as some constructs may show delayed targeting efficiency .

A comprehensive table comparing different cTPs based on their properties and experimentally determined targeting efficiencies can guide the selection of the most suitable cTP for CAB21:

cTP SourceTargeting Efficiency (% of Control)Time to Maximum Targeting (HAI)Cleavage EfficiencySource
AtRbcS1A100 (reference)72-96High
At1g63970~150-20048-72High
At2g20920~180-22048-60Medium-High
At2g24090Variable36-48Low (nonspecific)

What are the best approaches for analyzing CAB21 expression under different stress conditions?

Analyzing CAB21 expression under different stress conditions requires a comprehensive experimental design that accounts for multiple factors:

  • Experimental Design Framework:

    • Independent variable: Stress condition (e.g., drought, cold, heat, salt, pathogen infection, or chemical treatments)

    • Dependent variable: CAB21 expression level (transcript and/or protein)

    • Controlled variables: Plant age, growth conditions, time of day for sampling

  • Stress Application Protocols:

    • Cold stress: Expose plants to 4°C for varying durations (6h, 12h, 24h, 48h)

    • Drought stress: Withhold water until specified soil moisture levels or leaf water potentials are reached

    • Salt stress: Apply NaCl solutions at different concentrations (e.g., 100mM, 200mM)

    • Hormone treatments: Apply ABA, SA, or JA at physiologically relevant concentrations

  • Multi-level Analysis Approach:

    • Transcript level: Use qRT-PCR with appropriate reference genes for normalization

    • Protein level: Western blotting with CAB21-specific antibodies

    • In vivo localization: Transgenic plants expressing CAB21-fluorescent protein fusions

    • Functional analysis: Chlorophyll fluorescence measurements to assess photosynthetic efficiency

  • Time-Course Analysis:

    • Sample collection at multiple time points is crucial, as CAB gene expression may show biphasic responses

    • Based on studies with related CAB genes, expression patterns can vary significantly depending on stress type and duration

  • Data Analysis Framework:

    • Normalize expression data against unstressed controls

    • Apply appropriate statistical tests (ANOVA with post-hoc tests)

    • Perform principal component analysis or hierarchical clustering to identify expression patterns across different stresses

Based on studies of homologous CAB genes in tea plants, different members of the CAB gene family respond differently to various stresses. For example, some CAB genes are downregulated under most stress conditions, while others show upregulation specifically under cold stress and ABA treatment . This differential expression pattern suggests specialized roles for different CAB family members in stress adaptation.

What are the challenges in purifying functional recombinant CAB21?

Purifying functional recombinant CAB21 presents several significant challenges that researchers must address through careful experimental design:

  • Maintaining Protein Integrity:

    • CAB proteins contain multiple transmembrane domains that can cause aggregation during expression and purification

    • The hydrophobic nature of chlorophyll-binding domains makes these proteins prone to misfolding in the absence of their natural lipid environment

    • Researchers have reported difficulties in synthesizing intact recombinant CAB-GFP fusion proteins, with nonspecific cleavage by both bacterial and plant peptidases affecting protein integrity

  • Chlorophyll Association:

    • Functional CAB21 requires association with chlorophyll molecules

    • Expression in non-photosynthetic systems lacks the necessary chlorophyll molecules for proper folding and function

    • Reconstitution with chlorophyll in vitro is technically challenging and often results in low yields of functional protein

  • Expression System Selection:

    • Bacterial systems: Simple but lack post-translational modifications and chloroplast environment

    • Plant-based systems: More natural environment but lower yields and more complex purification

    • Cell-free systems: Offer control over reaction conditions but are costly and scale-limited

  • Purification Strategy Development:

    • Detergent selection is critical for solubilizing membrane proteins without denaturing them

    • Multi-step purification protocols often needed (affinity chromatography followed by size exclusion)

    • The presence of the chloroplast transit peptide can complicate purification and may require its removal for functional studies

  • Functional Validation Methods:

    • Spectroscopic analysis to confirm chlorophyll binding

    • Reconstitution into liposomes to verify membrane integration

    • In vitro energy transfer assays to confirm light-harvesting capability

How to design experiments to study CAB21 localization in chloroplasts?

Designing experiments to study CAB21 localization in chloroplasts requires a systematic approach combining molecular biology, microscopy, and biochemical techniques:

  • Construct Design for Fluorescence Tracking:

    • Create fusion constructs linking CAB21 (or its transit peptide) to fluorescent reporter proteins like GFP(S65T)

    • Include appropriate promoters (e.g., CaMV 35S for strong expression or native CAB21 promoter for physiological relevance)

    • Design constructs with the fluorescent tag at the C-terminus to avoid interfering with the N-terminal transit peptide

    • Generate control constructs: free GFP (negative control) and known chloroplast-targeted proteins like AtRbcS1A-GFP (positive control)

  • Transient Expression System:

    • Use Agrobacterium-mediated transformation for transient expression in Nicotiana tabacum leaves

    • Perform agroinfiltration with bacterial suspensions at standardized optical densities (typically OD600 = 0.5-0.8)

    • Include appropriate controls in each experiment to allow for direct comparisons

  • Confocal Laser-Scanning Microscopy Analysis:

    • Collect leaf samples at multiple time points post-infiltration (24, 48, 72, and 96 HAI) to capture the temporal dynamics of protein localization

    • Use standardized imaging parameters (laser power, gain, pinhole size) for quantitative comparisons

    • Capture z-stack images to ensure comprehensive visualization of chloroplast localization

  • Quantification Methods:

    • Measure GFP fluorescence intensity within chloroplasts relative to total cellular fluorescence

    • Calculate the chloroplast targeting efficiency using the formula:
      Targeting Efficiency=Chloroplast FluorescenceTotal Cellular Fluorescence×100%\text{Targeting Efficiency} = \frac{\text{Chloroplast Fluorescence}}{\text{Total Cellular Fluorescence}} \times 100\%

    • Analyze multiple cells (>30) from different leaf areas to ensure statistical robustness

  • Biochemical Validation:

    • Isolate intact chloroplasts from transformed leaves using Percoll gradient centrifugation

    • Perform immunoblot analysis using antibodies against GFP to detect:
      a) Precursor form (unprocessed, with transit peptide)
      b) Mature form (processed, transit peptide cleaved)

    • Compare band patterns with positive and negative controls to confirm authentic chloroplast localization

  • In Vitro Import Assays:

    • Express and purify recombinant CAB21-GFP proteins

    • Incubate with isolated chloroplasts in the presence of ATP

    • Monitor time-dependent import and processing through immunoblotting

    • Use thermolysin treatment to distinguish between surface-bound and imported proteins

This comprehensive approach allows for both qualitative and quantitative assessment of CAB21 localization to chloroplasts, providing insights into the efficiency of targeting and the factors that might influence it under different conditions.

What are the key considerations when designing constructs for expressing recombinant CAB21?

When designing constructs for expressing recombinant CAB21, researchers should consider multiple factors to optimize expression, localization, and functionality:

  • Vector Selection:

    • Expression host compatibility (plant, bacterial, yeast systems)

    • Promoter strength and inducibility (constitutive vs. inducible)

    • Selection markers for stable transformation

    • Vector copy number and stability

  • Fusion Tags and Reporters:

    • Position of tags (N-terminal tags may interfere with transit peptide function)

    • Size and nature of fusion partners (small tags like His6 vs. larger proteins like GFP)

    • Inclusion of linker sequences to minimize steric hindrance

    • Cleavable tags with appropriate protease recognition sites

  • Sequence Optimization:

    • Codon optimization for the expression host

    • Removal of cryptic splice sites for eukaryotic expression

    • Consideration of mRNA secondary structures that might impact translation efficiency

    • Inclusion or exclusion of the native transit peptide depending on the experimental goals

  • Structural Considerations for CAB21:

    • Preservation of transmembrane domains and chlorophyll-binding sites

    • Maintenance of functional domains identified through homology to other CAB proteins

    • Consideration of potential post-translational modification sites

    • Preservation of internal repeat regions that contribute to protein folding and function

  • Control Elements:

    • Inclusion of ribosome binding sites optimized for the expression system

    • Appropriate termination sequences

    • Kozak sequence optimization for eukaryotic expression

    • Inclusion of introns for enhanced expression in plant systems

A comparison table of different construct designs for expressing recombinant CAB21:

Construct DesignAdvantagesLimitationsBest Applications
Full-length CAB21 with native cTPNatural processing and targetingLower expression in non-plant systemsIn planta functional studies
CAB21 without cTPHigher expression in heterologous systemsRequires artificial targeting for chloroplast studiesBiochemical and structural studies
cTP-GFP-CAB21Visualizable targetingMay affect protein functionLocalization studies
CAB21-His6Simple purificationPotential interference with functionProtein-protein interaction studies
Split CAB21 domainsAnalysis of domain-specific functionsLoss of holistic protein propertiesDomain mapping studies

Based on studies with similar proteins, researchers have successfully used constructs with the cTP fused to GFP for tracking chloroplast localization . For functional studies of CAB proteins, maintaining the integrity of chlorophyll-binding domains is essential, as these are critical for the protein's role in photosynthesis .

How to analyze changes in CAB21 expression in response to environmental stressors?

Analyzing changes in CAB21 expression in response to environmental stressors requires a comprehensive experimental approach that integrates multiple analytical techniques:

  • Experimental Design Framework:

    • Define clear hypotheses about how specific stressors affect CAB21 expression

    • Use a factorial design to test multiple stressors and their interactions

    • Include appropriate time points to capture both early and late responses

    • Ensure adequate biological replication (minimum 3-5 biological replicates)

  • Stress Treatment Protocols:

    • Standardize stress application methods for reproducibility

    • Document all environmental parameters (light intensity, temperature, humidity)

    • Include both acute (short-term, high intensity) and chronic (long-term, moderate intensity) stress treatments

    • Consider combined stresses that mimic natural conditions

  • Transcript Level Analysis:

    • qRT-PCR with validated reference genes specific to the stress conditions

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Calculate relative expression using the 2^(-ΔΔCt) method with proper normalization

    • Create time-course expression profiles to visualize dynamic changes

  • Protein Level Analysis:

    • Western blotting with specific antibodies against CAB21

    • Quantitative proteomics approaches (iTRAQ or TMT labeling)

    • Analysis of post-translational modifications that may regulate protein function

    • Correlation between transcript and protein abundance changes

  • Data Integration and Visualization:

    • Heat maps showing expression changes across different stresses and time points

    • Principal component analysis to identify major patterns in the data

    • Network analysis to place CAB21 in the context of other stress-responsive genes

Based on studies with homologous CAB genes in tea plants, researchers can expect various response patterns. For example, some CAB gene family members show consistent downregulation under multiple stresses, while others exhibit stress-specific responses, such as upregulation only under cold stress and ABA treatment . This suggests specialized roles for different CAB proteins in stress adaptation mechanisms.

Sample data table format for representing CAB21 expression changes under different stresses:

Stress Condition6h (Fold Change)12h (Fold Change)24h (Fold Change)48h (Fold Change)Pattern Classification
Cold (4°C)0.8 ± 0.11.2 ± 0.21.5 ± 0.31.3 ± 0.2Late upregulation
Drought0.7 ± 0.10.5 ± 0.10.3 ± 0.10.2 ± 0.05Progressive downregulation
Salt (200mM NaCl)0.9 ± 0.20.7 ± 0.10.4 ± 0.10.5 ± 0.1Moderate downregulation
ABA (100μM)1.1 ± 0.21.4 ± 0.31.6 ± 0.31.2 ± 0.2Transient upregulation
Wounding0.8 ± 0.10.6 ± 0.10.5 ± 0.10.4 ± 0.1Progressive downregulation

How can protein-protein interactions of CAB21 be studied in vivo?

Studying protein-protein interactions of CAB21 in vivo requires specialized techniques that can capture these interactions within the complex environment of the chloroplast:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein (e.g., YFP) into N- and C-terminal fragments

    • Fuse these fragments to CAB21 and potential interaction partners

    • Co-express in tobacco leaves via agroinfiltration

    • Observe fluorescence restoration using confocal microscopy when proteins interact

    • Quantify interaction strength by measuring fluorescence intensity

  • Förster Resonance Energy Transfer (FRET):

    • Create CAB21 fusions with donor fluorophores (e.g., CFP)

    • Create potential partner protein fusions with acceptor fluorophores (e.g., YFP)

    • Co-express in plant cells and measure energy transfer between fluorophores

    • Calculate FRET efficiency as a measure of interaction proximity

    • Use acceptor photobleaching or fluorescence lifetime imaging for quantification

  • Co-Immunoprecipitation (Co-IP) from Chloroplasts:

    • Create transgenic plants expressing tagged versions of CAB21 (e.g., FLAG or HA tag)

    • Isolate intact chloroplasts and solubilize membrane proteins with mild detergents

    • Perform immunoprecipitation using tag-specific antibodies

    • Identify co-precipitating proteins by mass spectrometry

    • Validate specific interactions with immunoblotting

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse CAB21 to a promiscuous biotin ligase (BirA*)

    • Express the fusion protein in plant cells

    • The BirA* enzyme will biotinylate proteins in close proximity to CAB21

    • Isolate biotinylated proteins using streptavidin affinity purification

    • Identify interacting proteins by mass spectrometry

  • Genetic Interaction Approaches:

    • Generate CAB21 knockdown or knockout lines

    • Examine the expression profiles of other photosystem components

    • Look for compensatory changes in other CAB family members

    • Perform epistasis analysis with mutants of potential interacting partners

Based on studies with homologous CAB proteins, potential interaction partners to investigate include:

  • Other LHC family proteins in the PSII supercomplex

  • Photosystem II core proteins

  • Proteins involved in chlorophyll biosynthesis

  • Regulatory proteins containing domains like SH3 (Src Homology-3) that may interact with the SH3 domain found in some CAB proteins

When analyzing the results, it's important to consider that interactions may be dynamic and dependent on light conditions, developmental stage, or stress responses. The presence of functional domains like SH3 in CAB proteins suggests they may be regulated through protein-protein interactions, potentially as part of a signal transduction pathway responding to environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.