Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 36, chloroplastic (CAB36)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CAB36; Chlorophyll a-b binding protein 36, chloroplastic; LHCII type I CAB-36; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-265
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
CAB36
Target Protein Sequence
RRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSI LAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK
Uniprot No.

Target Background

Function

Function: The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is CAB36 and what is its fundamental role in photosynthesis?

CAB36 is a chlorophyll-binding protein found in the chloroplast of Nicotiana tabacum (tobacco). It belongs to the light-harvesting complex family and functions primarily in capturing light energy and transferring it to photosynthetic reaction centers. The protein (P27494) spans amino acids 38-265 in its mature form and contains specific binding sites for both chlorophyll a and chlorophyll b molecules .

Similar to other light-harvesting complex proteins, CAB36 likely contributes to the organization of photosystem architecture. Based on studies of related proteins, CAB36 is involved in maintaining the efficiency of photosynthesis by optimizing light absorption across different wavelengths of the visible spectrum. The protein likely participates in both direct light harvesting and photoprotection mechanisms that safeguard the photosynthetic apparatus from excess light damage .

What expression systems yield optimal results for recombinant CAB36 production?

Based on the available research, E. coli represents an effective expression system for producing recombinant CAB36. The protocol typically involves:

Expression SystemVector TypeTagExpression ConditionsYield Factors
E. colipET seriesN-terminal His-tagIPTG induction, 18-25°CGrowth temperature, induction time, media composition

The standard procedure employs a bacterial expression system with the following considerations:

  • Codon optimization for E. coli expression may be necessary given the plant origin of the protein

  • Lower induction temperatures (18-25°C) likely improve proper folding and reduce inclusion body formation

  • N-terminal His-tagging facilitates purification while minimizing interference with chlorophyll-binding domains

For functional studies requiring proper pigment binding, alternative expression systems such as plant-based or algal systems might be preferable, though these would require different methodological approaches than the E. coli system documented in the current research .

What purification strategies maximize yield and activity of recombinant CAB36?

Efficient purification of recombinant His-tagged CAB36 can be achieved through:

  • Initial clarification of bacterial lysate via high-speed centrifugation (10,000-15,000g)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing with increasing imidazole concentrations (10-40mM) to remove non-specific binding

  • Elution with higher imidazole concentrations (250-300mM)

  • Buffer exchange to remove imidazole and stabilize the protein

For subsequent experimental applications, consider these additional purification steps:

Purification MethodApplicationAdvantagesLimitations
Size exclusion chromatographyObtaining monomeric proteinRemoves aggregates, provides size validationDilutes sample, may affect oligomeric states
Ion exchange chromatographyRemoving endotoxins or DNA contaminantsHigh resolution, maintains activitySalt conditions may affect stability

Post-purification, the protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability. Adding glycerol to 5-50% final concentration before aliquoting helps preserve activity during freeze-thaw cycles .

How can recombinant CAB36 be used to study photosystem assembly and dynamics?

Recombinant CAB36 provides a valuable tool for investigating photosystem assembly through several methodological approaches:

  • In vitro reconstitution studies:

    • Mixing purified recombinant CAB36 with isolated photosystem components

    • Monitoring complex formation using analytical ultracentrifugation or native gel electrophoresis

    • Assessing energy transfer efficiency through fluorescence spectroscopy

  • Protein-protein interaction assays:

    • Employing co-immunoprecipitation with antibodies against CAB36 or its binding partners

    • Using surface plasmon resonance to determine binding kinetics

    • Performing fluorescence resonance energy transfer (FRET) analysis to map interaction domains

  • Structural studies:

    • Crystallization trials with and without bound pigments

    • Cryo-electron microscopy of reconstituted complexes

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Research with homologous light-harvesting complexes suggests that the fluorescence emission properties of these proteins change with their aggregation state, which may serve as a useful experimental parameter for tracking assembly dynamics . By monitoring spectral shifts (particularly in the 705 nm range for related proteins), researchers can gain insights into conformational changes during complex formation.

What experimental approaches can effectively characterize CAB36's pigment binding properties?

Characterization of CAB36's pigment binding requires multiple complementary techniques:

TechniqueMeasurementMethodologyData Interpretation
Absorption spectroscopyPigment binding specificityScan 350-750 nm before and after reconstitution with chlorophyllsCompare ratios of peaks at 440-470 nm (Chl a) and 650-660 nm (Chl b)
Circular dichroismProtein-pigment complex structureFar-UV (190-260 nm) and visible range (400-700 nm)Secondary structure elements and pigment-protein interactions
Fluorescence spectroscopyEnergy transfer efficiencyExcitation at Chl b absorption maxima, emission scanQuenching of Chl b emission and enhancement of Chl a emission indicates transfer

The experimental design should include both positive controls (well-characterized homologous proteins) and negative controls (denatured protein or non-binding mutants). Analysis of spectroscopic data can reveal the stoichiometry of chlorophyll a to chlorophyll b binding, which typically ranges from 1:1 to 3:1 in light-harvesting complexes .

For determining binding constants and thermodynamic parameters, isothermal titration calorimetry can provide quantitative measures of pigment-protein interactions.

What statistical frameworks are appropriate for analyzing CAB36 experimental data?

Effective statistical analysis of CAB36 experimental data requires frameworks appropriate to the specific experimental design:

Experimental ApproachRecommended Statistical MethodImplementation DetailsInterpretation Guidelines
Comparative binding studiesANOVA with Tukey's post-hoc testUse R packages for factorial design analysisConsider both statistical and biological significance
Dose-response assaysNon-linear regression modelsDetermine EC50 values and confidence intervalsCompare binding affinity across experimental conditions
Time-course experimentsRepeated measures ANOVA or mixed-effects modelsAccount for within-subject correlationEvaluate temporal patterns in protein activity

For experiments with complex factorial designs, follow these guidelines:

  • Design experiments with sufficient replication (minimum n=3 biological replicates)

  • Include appropriate controls for each experimental condition

  • Consider power analysis to determine sample size requirements

  • Apply corrections for multiple comparisons when necessary

The experimental design principles taught in courses like MMC 6936 (Experimental Design & Analysis) emphasize that proper statistical analysis begins with thoughtful experimental design, including consideration of internal validity, external validity, and potential confounds .

What are common challenges in CAB36 expression and how can they be overcome?

Recombinant CAB36 expression presents several challenges that researchers can address through specific methodological adjustments:

ChallengePotential CausesSolution ApproachValidation Method
Low expression yieldCodon bias, toxicity to hostOptimize codons, use tightly regulated expression systemsSDS-PAGE quantification
Inclusion body formationRapid expression, improper foldingLower induction temperature (16-18°C), co-express chaperonesSolubility fractionation analysis
Degradation during purificationProtease activityAdd protease inhibitors, reduce purification timeWestern blot with anti-His antibody
Poor pigment bindingIncorrect foldingReconstitution in lipid environments, controlled denaturation-renaturationAbsorption spectroscopy

For inclusion body recovery, a systematic refolding approach may be necessary:

  • Solubilize inclusion bodies in 8M urea or 6M guanidine-HCl

  • Perform rapid dilution or dialysis with decreasing denaturant concentrations

  • Include stabilizing agents such as glycerol, trehalose, or mild detergents

  • Monitor refolding by tryptophan fluorescence and circular dichroism

  • Verify functionality through pigment binding assays

Maintaining protein stability during storage is critical - lyophilization with 6% trehalose provides long-term stability, while avoiding repeated freeze-thaw cycles preserves activity. For working solutions, store aliquots at 4°C for no more than one week .

How can researchers optimize experimental protocols for studying CAB36-pigment interactions?

Optimizing CAB36-pigment interaction studies requires careful attention to experimental conditions:

  • Buffer optimization:

    • Screen different pH conditions (typically 7.0-8.5)

    • Test various salt concentrations (50-200 mM)

    • Include stabilizing agents (glycerol, sucrose, or mild detergents)

  • Pigment preparation:

    • Freshly extract chlorophylls or use high-purity commercial preparations

    • Maintain chlorophylls in organic solvents until immediately before use

    • Prepare working solutions in dim light and under nitrogen to prevent oxidation

  • Reconstitution methodology:

    • Start with pigment:protein molar ratios of 5:1 to ensure saturation

    • Gradually remove detergent through dialysis or adsorption to Bio-Beads

    • Monitor reconstitution by tracking spectral changes

  • Analysis optimizations:

    • Perform measurements promptly after reconstitution

    • Include antioxidants to prevent pigment degradation

    • Use temperature-controlled chambers for spectroscopic measurements

Incorporating controls is essential: parallel experiments with denatured protein can distinguish specific binding from non-specific interactions, while established chlorophyll-binding proteins can serve as positive controls for reconstitution efficiency.

For advanced studies, consider isolating native CAB36 from tobacco plants for comparative analysis with the recombinant protein, which can help validate the functional relevance of in vitro findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.