Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 50, chloroplastic (CAB50)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 50, chloroplastic (CAB50), is a protein that, in Nicotiana tabacum (tobacco), is tagged with histidine and expressed in E. coli . CAB50, also known as Chlorophyll a-b binding protein 50, chloroplastic, LHCII type I CAB-50, or LHCP, functions in conjunction with other proteins in a variety of pathways .

Basic Information

CharacteristicDescription
SpeciesNicotiana tabacum
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (36-267)
FormLyophilized powder
AA SequenceRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKHIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
PurityGreater than 90% as determined by SDS-PAGE
ApplicationsSDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
Gene NameCAB50
SynonymsCAB50; Chlorophyll a-b binding protein 50, chloroplastic; LHCII type I CAB-50; LHCP
UniProt IDP27496

Function and Role

CAB50 has several biochemical functions and interacts directly with other proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays .

Wettability of Bituminous Coal

CAB-50 can be used to improve the wettability of bituminous coal . Amphoteric ionic solutions containing CAB-50 can decrease the contact angles on coal samples by an average of 65.46% compared to pure water. Specifically, a solution of CAB-50 can decrease the contact angle by 69.79% to only 19.86°, which is the lowest among amphoteric ionic surfactants .

SolutionContact Angle (°)Surface Tension (mN/m)
Pure Water65.7472.3
CAB-50 (0.5 wt%)19.8633.3
SDS (0.5 wt%)N/A26.5

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
CAB50; Chlorophyll a-b binding protein 50, chloroplastic; LHCII type I CAB-50; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
CAB50
Target Protein Sequence
RKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKH IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Uniprot No.

Target Background

Function
The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Chlorophyll a-b binding protein 50 (CAB50) and what is its function in Nicotiana tabacum?

Chlorophyll a-b binding protein 50 (CAB50) is a light-harvesting complex protein located in the chloroplasts of Nicotiana tabacum (tobacco). It belongs to a family of proteins that bind chlorophyll molecules and function primarily to collect and transfer light energy to photosynthetic reaction centers. CAB50 specifically binds both chlorophyll a and b pigments, forming part of the antenna complex that increases the light-capturing surface area for photosystems. This protein plays a critical role in optimizing photosynthetic efficiency by facilitating energy transfer from absorbed light to the photosynthetic reaction centers.

How is CAB50 transported to the chloroplast?

CAB50, like other chloroplast-targeted proteins, is nuclear-encoded and synthesized in the cytosol as a precursor containing an N-terminal chloroplast-targeting peptide (cTP). This cTP directs the protein to the chloroplast through the TOC/TIC (Translocon at the Outer/Inner Chloroplast envelope membrane) complex. Recent research has identified highly efficient chloroplast-targeting peptides that can significantly improve the delivery of recombinant proteins to chloroplasts . During or after translocation into the chloroplast, the cTP is cleaved by the stromal processing peptidase, converting the "precursor" form to the "mature" form of the protein . The import process is time-dependent and can be monitored using fusion proteins such as cTP-GFP constructs .

What techniques are commonly used to measure CAB concentration (Cab) in plant tissues?

Several techniques are used to measure chlorophyll a-b binding protein concentration (Cab) in plant tissues:

  • Spectrophotometric methods: Traditional approach measuring absorption at specific wavelengths.

  • Immunological techniques: Western blotting and ELISA using specific antibodies.

  • Remote sensing indices: Non-destructive measurements using vegetation indices such as:

    • Chlorophyll Index green (CIgreen)

    • Chlorophyll Index red edge (CIre)

    • MTCI (MERIS Terrestrial Chlorophyll Index)

    • NDRE (Normalized Difference Red Edge)

    • BNDVI (Blue Normalized Difference Vegetation Index)

Research shows that these spectral indices correlate with Cab measurements, with BNDVI-based regression models demonstrating the highest accuracy (R² of 0.746) .

How can recombinant CAB50 expression systems be optimized for experimental studies?

Optimizing recombinant CAB50 expression requires a comprehensive approach addressing several key factors:

  • Selection of expression system: For plant proteins like CAB50, plant-based expression systems often provide correct post-translational modifications. Nicotiana benthamiana transient expression via agroinfiltration has proven effective for chloroplast proteins .

  • Chloroplast targeting optimization: Selecting an efficient chloroplast-targeting peptide is crucial. Recent research has identified cTPs with significantly higher chloroplast-targeting efficiencies than the commonly used AtRbcS1A cTP from Arabidopsis thaliana . Notably, cTPs from At1g63970 and At2g20920 demonstrated superior import capability into isolated tobacco chloroplasts compared to standard cTPs .

  • Expression monitoring protocol:

    • Sample leaf tissue at multiple time points (24, 36, 48, 60, 72, and 96 hours post-infiltration)

    • Assess transcript levels using qRT-PCR

    • Quantify protein accumulation using fluorometric measurements (when using fluorescent tags)

    • Confirm chloroplast localization via confocal microscopy

  • Protein detection optimization: Use of specific antibodies against CAB50 or fusion tags (His, FLAG, GFP) for protein detection and quantification.

What are the key considerations when designing experiments to investigate CAB50 interactions with other photosynthetic proteins?

When investigating CAB50 interactions with other photosynthetic proteins, researchers should consider:

  • In vitro interaction studies:

    • Co-immunoprecipitation assays using recombinant proteins

    • Pull-down assays with tagged CAB50

    • Surface plasmon resonance to quantify binding affinities

    • Fluorescence resonance energy transfer (FRET) for proximity analysis

  • In vivo interaction studies:

    • Bimolecular fluorescence complementation (BiFC)

    • Split-GFP assays in transiently transfected tobacco leaves

    • Co-localization studies using confocal microscopy

  • Structural considerations: CAB50's membrane-embedded nature requires careful buffer selection containing appropriate detergents for solubilization while maintaining native protein conformation.

  • Controls: Include positive controls (known interacting proteins) and negative controls (unrelated chloroplast proteins) to validate interaction specificity.

  • Physiological relevance: Confirm interactions under different light conditions and developmental stages, as photosynthetic protein interactions often change in response to environmental cues.

How do statistical regression models compare with machine learning approaches for CAB50 quantification from multispectral data?

Statistical regression models and machine learning approaches for CAB50 quantification from multispectral data offer different advantages and limitations:

Comparative Performance Analysis:

MethodR² (Cab)RMSE (Cab)Key AdvantagesLimitations
Statistical Regression (Coupled Model)0.635Not specifiedNo prior measurements needed; Fast implementation; Physically interpretableLower accuracy than ML approaches; Relies on model parameters
LSSVM (Least Squares Support Vector Machine)<0.835>4.567Good predictive power; Handles non-linear relationshipsRequires extensive training data; Less interpretable
RF (Random Forest)<0.835>4.567Handles variable importance; Robust to outliersRequires large training datasets; Potential overfitting
Optimal Estimation Method0.8354.567Integrates simulated and observed data; Corrects inversion value underestimationComputationally intensive; Complex implementation

What protocol should be followed for efficient chloroplast isolation to study native CAB50?

Efficient Chloroplast Isolation Protocol for Native CAB50 Studies:

  • Plant material preparation:

    • Grow Nicotiana tabacum plants under controlled conditions (16/8 hour light/dark cycle, 22-24°C)

    • Harvest young, fully expanded leaves in the morning to maximize chloroplast integrity

    • Keep all materials and solutions ice-cold throughout the procedure

  • Isolation buffer preparation:

    • 330 mM sorbitol

    • 50 mM HEPES-KOH (pH 7.3)

    • 1 mM MgCl₂

    • 1 mM EDTA

    • 0.1% BSA

    • 1 mM DTT (add fresh)

    • Protease inhibitor cocktail

  • Homogenization and filtration:

    • Cut leaves into small pieces (~1 cm²)

    • Homogenize in cold isolation buffer using a blender (3×5 second pulses)

    • Filter homogenate through four layers of miracloth and one layer of nylon mesh (100 μm)

  • Differential centrifugation:

    • Centrifuge filtrate at 1,000×g for 5 minutes at 4°C

    • Carefully resuspend the pellet in isolation buffer

    • Layer onto a Percoll gradient (40%/80%) and centrifuge at 3,000×g for 15 minutes

    • Collect intact chloroplasts at the 40%/80% interface

  • Quality assessment:

    • Check chloroplast integrity with phase contrast microscopy

    • Perform Hill reaction assay to verify functionality

    • Quantify chlorophyll concentration spectrophotometrically

  • CAB50 analysis from isolated chloroplasts:

    • Extract total chloroplast proteins using appropriate buffer

    • Perform SDS-PAGE followed by western blotting with anti-CAB50 antibodies

    • For time-dependent import studies, incubate recombinant precursor proteins with isolated chloroplasts and analyze as demonstrated in recent chloroplast import studies

How can researchers accurately measure changes in CAB50 expression under different environmental stresses?

To accurately measure changes in CAB50 expression under environmental stresses, researchers should implement a multi-level analysis approach:

  • Transcript level analysis:

    • Isolate total RNA using TRIzol or RNeasy Plant kits

    • Perform RT-qPCR with CAB50-specific primers

    • Normalize expression to multiple reference genes (e.g., ACT2, UBQ10, EF1α)

    • Use at least 3-4 biological replicates and 3 technical replicates

  • Protein level analysis:

    • Extract total protein or chloroplast-enriched fractions

    • Perform western blotting with CAB50-specific antibodies

    • Use densitometry for quantification

    • Include loading controls (RbcL or total protein staining)

  • Post-translational modification analysis:

    • Use Phos-tag gels to detect phosphorylation changes

    • Employ immunoprecipitation followed by mass spectrometry

  • Remote sensing approach for field studies:

    • Utilize multispectral imaging with vegetation indices

    • Apply the optimal estimation method that combines physical model simulation with empirical measurements

    • Calculate Cab using validated spectral indices (BNDVI shows highest accuracy)

  • Experimental design considerations:

    • Include proper controls (non-stressed plants)

    • Implement time-course sampling to capture dynamic responses

    • Standardize stress application methods

    • Document phenotypic responses alongside molecular measurements

What are the best practices for designing recombinant CAB50 constructs for chloroplast targeting studies?

When designing recombinant CAB50 constructs for chloroplast targeting studies, researchers should follow these best practices:

  • Selection of optimal chloroplast-targeting peptides (cTPs):

    • Test multiple cTPs as fusion partners rather than relying solely on the native CAB50 cTP

    • Consider cTPs from highly expressed chloroplast proteins

    • Recent research has identified several cTPs with significantly higher chloroplast-targeting efficiencies than the commonly used AtRbcS1A cTP

    • Among 89 tested cTPs, 48 showed chloroplast-specific localization with varying efficiencies

  • Fusion protein design considerations:

    • Include a flexible linker (e.g., GGGGS) between the cTP and CAB50

    • For visualization, C-terminal tags are preferable as N-terminal tags may interfere with targeting

    • GFP(S65T) has been successfully used to track chloroplast import

    • Consider using smaller tags (e.g., FLAG, HA, His) for functional studies

  • Expression vector selection:

    • For transient expression, pCAMBIA-based vectors work well with Agrobacterium

    • Include strong promoters (35S, ubiquitin) for high expression

    • Consider inducible promoters for controlled expression studies

  • Verification methods:

    • Confocal microscopy to confirm chloroplast localization

    • Western blotting to detect precursor (unimported) and mature (imported) forms

    • Import time-course analysis to evaluate efficiency

    • Chloroplast fractionation to confirm integration into thylakoid membranes

  • Optimization strategies:

    • Test expression at different time points post-infiltration (24-96 hours)

    • Adjust Agrobacterium concentration (OD₆₀₀) for optimal expression

    • Consider co-expression with silencing suppressors (p19) to enhance expression levels

How can researchers address common issues in CAB50 protein extraction and purification?

Common Issues and Solutions in CAB50 Extraction and Purification:

IssuePossible CausesSolutions
Low protein yieldInsufficient starting material; Protein degradation; Poor extractionIncrease sample amount; Add additional protease inhibitors; Optimize buffer composition; Keep samples cold
Multiple bands on western blotProtein degradation; Post-translational modifications; Incomplete processing of cTPUse fresher tissue; Add phosphatase inhibitors for PTM analysis; Compare with import controls to identify precursor/mature forms
Poor solubilityMembrane association; Protein aggregationInclude mild detergents (0.5-1% Triton X-100, 0.1% DDM); Test different detergent concentrations; Consider native extraction conditions
Contamination with RuBisCOInefficient separationUse differential centrifugation; Employ ammonium sulfate fractionation; Consider immunoprecipitation approaches
Loss of protein activityDenaturation during purification; Cofactor lossInclude stabilizers (glycerol, reducing agents); Maintain native binding partners where possible; Purify under mild conditions
Poor chloroplast targetingInefficient cTP; Sub-optimal expression conditionsTest alternative cTPs with higher efficiency ; Optimize Agrobacterium concentration; Adjust incubation time and temperature

When troubleshooting, implement a systematic approach by changing one variable at a time and documenting all modifications to the protocol. For recombinant protein work, analyze both the soluble and membrane fractions to determine protein distribution, as CAB50 is naturally membrane-associated in thylakoids.

What statistical approaches are most appropriate for analyzing CAB50 expression data across different experimental conditions?

When analyzing CAB50 expression data across different experimental conditions, several statistical approaches should be considered:

  • Descriptive statistics:

    • Calculate means, standard deviations, and standard errors

    • Generate box plots to visualize data distribution

    • Consider normalization methods appropriate for the type of data

  • Inferential statistics for hypothesis testing:

    • For normally distributed data:

      • t-test (two conditions)

      • One-way ANOVA with post-hoc tests (multiple conditions)

      • Two-way ANOVA for factorial designs (e.g., stress × time interactions)

    • For non-normally distributed data:

      • Mann-Whitney U test (two conditions)

      • Kruskal-Wallis test with Dunn's post-hoc comparison (multiple conditions)

  • Correlation and regression analyses:

    • Pearson correlation for linear relationships

    • Spearman rank correlation for non-linear monotonic relationships

    • Multiple regression to model relationships between CAB50 expression and multiple variables

  • Advanced modeling approaches:

    • For spectral data analysis, consider optimal estimation methods that integrate simulated and observed data

    • Compare statistical regression models with machine learning approaches like LSSVM and RF when appropriate

    • For time series data, repeated measures ANOVA or mixed models

  • Validation and reporting:

    • Report effect sizes alongside p-values

    • Include confidence intervals

    • Validate findings with independent experiments

    • Consider multiple testing corrections (e.g., Bonferroni, Benjamini-Hochberg FDR)

When analyzing CAB50 quantification from spectral indices, be aware that different indices show varying accuracy levels. Research indicates that for Cab estimation, BNDVI-based models demonstrate the highest accuracy (R² of 0.746), while simpler enhancement factor models may show slight over-prediction of values .

How should researchers interpret seemingly contradictory data related to CAB50 functions in different experimental systems?

When faced with seemingly contradictory data about CAB50 functions across different experimental systems, researchers should implement a structured approach to interpretation:

  • Systematic comparison of experimental conditions:

    • Catalog key differences in plant growth conditions (light intensity, photoperiod, temperature)

    • Compare protein extraction and analysis methods

    • Evaluate genetic backgrounds (wild-type vs. mutant, different species)

    • Consider developmental stages and tissue specificity

  • Critical evaluation of methodological limitations:

    • Assess sensitivity and specificity of detection methods

    • Consider artifacts introduced by fusion tags or overexpression

    • Evaluate whether in vitro conditions reflect in vivo reality

    • Examine temporal aspects (acute vs. chronic responses)

  • Integration of multi-level evidence:

    • Compare transcriptomic, proteomic, and phenotypic data

    • Consider post-translational modifications and protein-protein interactions

    • Evaluate subcellular localization data precisely

    • Examine data from multiple experimental approaches

  • Contextual interpretation:

    • Consider that CAB50 may have different functions depending on:

      • Developmental stage

      • Environmental conditions (stress responses)

      • Regulatory state of the photosynthetic apparatus

      • Association with different protein complexes

  • Resolution strategies:

    • Design experiments that directly address contradictions

    • Implement genetic approaches (knockouts, complementation)

    • Use quantitative methods with appropriate controls

    • Consider that contradictions may reveal novel regulatory mechanisms

For example, when analyzing CAB quantification from spectral indices, accuracy of the equilibrium model is the single most important source of deviation between experiments and models, particularly at high loadings . Understanding these limitations helps explain apparent contradictions between different measurement approaches.

What emerging technologies hold promise for advancing CAB50 research?

Several emerging technologies offer significant potential for advancing CAB50 research:

  • CRISPR/Cas9 genome editing:

    • Precise modification of CAB50 genes to study structure-function relationships

    • Creation of reporter lines with fluorescently tagged endogenous CAB50

    • Development of conditional knockouts for temporal studies

    • Base editing for subtle modifications without complete gene disruption

  • Advanced imaging technologies:

    • Super-resolution microscopy to visualize CAB50 organization within thylakoid membranes

    • Live-cell imaging with improved fluorescent proteins for real-time tracking

    • Correlative light and electron microscopy (CLEM) to connect protein localization with ultrastructure

    • Label-free imaging methods for non-invasive analysis

  • Synthetic biology approaches:

    • Design of artificial light-harvesting complexes based on CAB50 structure

    • Development of optimized chloroplast-targeting peptides for biotechnology applications

    • Creation of chimeric proteins with novel functions

    • Minimal redesign of photosynthetic complexes for improved efficiency

  • High-throughput phenotyping platforms:

    • Automated plant phenotyping systems with multispectral imaging

    • Integration of UAV-based remote sensing for field studies

    • Machine learning algorithms for improved data analysis and interpretation

    • Synchronous retrieval of multiple plant parameters from spectral data

  • Structural biology advances:

    • Cryo-electron microscopy for high-resolution structures of CAB50 in native complexes

    • Integrative structural biology combining multiple techniques (X-ray, NMR, mass spectrometry)

    • Molecular dynamics simulations to understand protein dynamics and interactions

    • Hydrogen-deuterium exchange mass spectrometry for protein-protein interaction mapping

These technologies, especially when used in combination, will help resolve outstanding questions about CAB50 function, regulation, and integration within the photosynthetic apparatus.

How might understanding CAB50 contribute to improving photosynthetic efficiency in crop plants?

Understanding CAB50 could significantly contribute to improving photosynthetic efficiency in crop plants through several mechanisms:

Achieving these improvements would require interdisciplinary approaches combining molecular biology, biochemistry, biophysics, and agronomic evaluation under field conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.