Recombinant Nicotiana tabacum Chlorophyll a-b binding protein 7, chloroplastic (CAB7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
CAB7; Chlorophyll a-b binding protein 7, chloroplastic; LHCII type I CAB-7; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-267
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
CAB7
Target Protein Sequence
RKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Database Links
Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of CAB7 in Nicotiana tabacum?

CAB7 (Chlorophyll a-b binding protein 7) is a critical component of the light-harvesting complex in tobacco chloroplasts. This protein plays an essential role in photosynthesis by binding chlorophyll molecules and facilitating energy transfer within the photosystem. The protein is encoded by nuclear DNA but functions within the chloroplast, making it a model protein for studying nuclear-chloroplast communication pathways. Understanding CAB7 provides insights into photosynthetic efficiency and plant adaptation to varying light conditions, which has implications for crop improvement in related Solanaceae family members.

What is the structural composition and properties of native CAB7?

The native CAB7 protein in Nicotiana tabacum consists of a mature protein sequence spanning amino acids 36-267, following cleavage of a transit peptide that directs the protein to the chloroplast . The protein contains multiple membrane-spanning domains that anchor it within the thylakoid membrane and specific binding sites for chlorophyll a and b molecules. The protein exhibits characteristic spectroscopic properties reflecting its association with pigment molecules, including specific absorption and fluorescence emission profiles that can be used for its identification and functional assessment.

How does CAB7 expression vary under different environmental conditions?

CAB7 expression shows significant variation in response to environmental factors, particularly light intensity and quality. The gene typically follows a diurnal expression pattern, with higher expression levels during daylight hours. Under high light stress, plants may downregulate CAB7 expression as part of photoprotective mechanisms, while low light conditions often trigger upregulation to maximize light capture efficiency. Temperature fluctuations and nutrient availability also influence CAB7 expression levels, making it an important marker for studying plant stress responses and adaptation mechanisms.

What are the optimal approaches for designing experiments to study CAB7 function?

When designing experiments to study CAB7 function, researchers should implement a systematic approach that includes both control and experimental groups to isolate the effect of variables on CAB7 expression or function . Begin with a specific research question, clearly defining independent variables (e.g., light intensity, temperature, genetic modification) and dependent variables (CAB7 expression levels, photosynthetic efficiency, plant growth) . For instance, when studying light effects on CAB7 expression, maintain all other variables constant while systematically varying light intensity or spectral quality.

A robust experimental design should include:

  • Appropriate controls (positive, negative, and vehicle controls when applicable)

  • Sufficient biological and technical replicates (minimum n=3 for each condition)

  • Randomization of experimental units to minimize bias

  • Blinding procedures where appropriate for objective measurements

  • Time-course measurements to capture dynamic changes in CAB7 expression

For transgenic studies, include both wild-type plants and plants transformed with empty vectors as controls to account for effects of the transformation process itself on CAB7 function .

What are the most reliable methods for quantifying CAB7 protein and transcript levels?

For transcript quantification:

  • Quantitative RT-PCR is the gold standard, requiring careful primer design specific to CAB7 to avoid cross-amplification of related family members

  • RNA-Seq provides genome-wide context for CAB7 expression changes

  • Northern blotting can be useful for size verification of transcripts

For protein quantification:

  • Western blotting with CAB7-specific antibodies remains the most common approach

  • ELISA assays can provide more quantitative data when standardized properly

  • Mass spectrometry offers the highest specificity and can identify post-translational modifications

When quantifying CAB7, researchers should normalize transcript levels to stable reference genes validated for the specific experimental conditions, and protein levels to total protein content or constitutively expressed proteins. For meaningful comparisons across different studies, standardized protocols and reference standards should be established and reported in detail.

How should researchers design control experiments when studying recombinant CAB7?

When studying recombinant CAB7, appropriate control experiments are crucial for reliable interpretation of results . Researchers should include:

  • Expression controls:

    • Empty vector controls to account for effects of the expression system

    • Unrelated protein controls expressed under the same conditions

    • Wild-type CAB7 as a positive control when studying mutant variants

  • Purification controls:

    • Mock purifications from non-transformed hosts

    • Purification of a known protein using identical methods

  • Functional assays:

    • Inclusion of commercial standards when available

    • Concentration gradients to establish dose-response relationships

    • Time-course experiments to capture temporal dynamics

Additionally, researchers should validate that the recombinant CAB7 maintains native properties through structural and functional comparison with the native protein. This may include circular dichroism to assess secondary structure, pigment binding assays, and spectroscopic analysis of chlorophyll binding capacity.

Which expression systems are most effective for producing functional recombinant CAB7?

Several expression systems have been evaluated for the production of recombinant CAB7, each with distinct advantages:

  • Bacterial expression (E. coli):

    • Offers rapid growth and high protein yields

    • Often results in inclusion bodies requiring refolding

    • His-tagged versions facilitate purification

    • May lack post-translational modifications essential for function

  • Plant-based expression (Nicotiana):

    • Provides native post-translational modifications

    • N. tabacum (cv. I 64) shows highest transient expression levels for recombinant proteins

    • Allows proper chloroplast targeting when including transit peptide

    • Yields functional protein with proper pigment association

  • Insect cell/baculovirus systems:

    • Intermediate between bacterial and mammalian systems

    • Supports some post-translational modifications

    • Higher yield than mammalian cells with more complex processing than bacteria

For functional studies, plant-based expression in Nicotiana hosts is generally superior as it provides the native cellular environment for proper folding and chloroplast targeting. Among various Nicotiana varieties, N. tabacum (cv. I 64) has demonstrated the highest transient concentrations of recombinant proteins, with substantial biomass production and relatively low alkaloid content . This makes it particularly suitable for research-scale production of functional CAB7.

What strategies can optimize the yield and quality of recombinant CAB7?

To optimize recombinant CAB7 production, researchers should consider multiple strategies:

  • Codon optimization:

    • Adapt the CAB7 coding sequence to the codon usage bias of the expression host

    • This approach has been demonstrated to significantly improve expression levels for recombinant proteins in tobacco

  • Signal/transit peptide optimization:

    • For chloroplast localization, include the native or optimized transit peptide

    • Consider using well-characterized alternative transit peptides if native targeting is inefficient

  • Expression enhancement:

    • Utilize strong promoters appropriate for the expression system

    • Include enhancer elements and optimized untranslated regions

    • Consider viral suppressor proteins to prevent silencing in plant systems

  • Post-harvest optimization:

    • Develop efficient extraction protocols specific to membrane proteins

    • Optimize detergent selection for solubilization while maintaining structure

    • Implement purification strategies that maintain chlorophyll association if required

A comprehensive approach combining these strategies typically yields the best results. For transient expression in tobacco, optimizing infiltration conditions (plant age, infiltration medium, optical density of Agrobacterium) can significantly impact recombinant protein yields .

How can researchers verify the structural integrity and functionality of recombinant CAB7?

Verification of recombinant CAB7 integrity requires multiple complementary approaches:

A functional recombinant CAB7 should demonstrate characteristic spectroscopic properties and pigment binding capacity comparable to the native protein. Researchers should report detailed methodology for these verification steps to ensure reproducibility across different laboratories.

How can CAB7 be utilized as a model for studying protein-targeting mechanisms to chloroplasts?

CAB7 serves as an excellent model for investigating protein import mechanisms into chloroplasts due to its nuclear encoding and chloroplastic localization. Researchers can leverage this system through:

  • Transit peptide analysis:

    • Systematic mutagenesis of the CAB7 transit peptide to identify critical residues

    • Creation of fusion constructs with reporter proteins to track targeting efficiency

    • Comparative studies of transit peptide function across different plant species

  • Protein import mechanism studies:

    • In vitro chloroplast import assays using recombinant CAB7 precursors

    • Crosslinking studies to identify translocon components interacting with CAB7

    • Competitive import assays to compare import efficiency with other chloroplast proteins

  • Regulatory investigations:

    • Analysis of how environmental conditions affect CAB7 import efficiency

    • Identification of cytosolic factors involved in pre-protein recognition

    • Studies on transit peptide processing and degradation

When designing these experiments, researchers should include appropriate controls such as proteins known to use different import pathways and truncated versions lacking transit peptides. Time-course experiments are particularly valuable for capturing the dynamic nature of the import process.

What approaches can be used to create CAB7 mutants for structure-function studies?

Creating and analyzing CAB7 mutants provides valuable insights into structure-function relationships:

  • Site-directed mutagenesis approaches:

    • Alanine scanning of conserved residues to identify functional hotspots

    • Conservative vs. non-conservative substitutions of chlorophyll-binding residues

    • Introduction of specific mutations based on computational predictions

  • Domain swapping:

    • Exchange domains between CAB7 and related light-harvesting proteins

    • Create chimeric proteins with components from distantly related species

    • Swap chlorophyll-binding motifs to alter pigment specificity

  • Modern genome editing:

    • CRISPR-Cas9 mediated mutation of CAB7 in planta

    • Prime editing for precise alterations without donor templates

    • Multiplexed editing to modify multiple CAB family members simultaneously

For structure-function analyses, researchers should combine in vitro characterization of recombinant mutant proteins with in vivo studies of transgenic plants expressing these variants. Correlation of spectroscopic properties with physiological phenotypes provides the most comprehensive understanding of functional implications.

How can systems biology approaches integrate CAB7 into photosynthetic network models?

Systems biology offers powerful frameworks for understanding CAB7's role within the broader photosynthetic apparatus:

  • Network analysis approaches:

    • Correlation analysis of CAB7 expression with other photosynthetic genes

    • Identification of transcription factor binding sites in the CAB7 promoter

    • Protein-protein interaction mapping of CAB7 within the light-harvesting complex

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data related to CAB7 function

    • Correlate CAB7 expression/abundance with photosynthetic efficiency metrics

    • Profile post-translational modifications under various environmental conditions

  • Computational modeling:

    • Develop kinetic models of energy transfer incorporating CAB7 parameters

    • Create structural models of CAB7-containing super-complexes

    • Simulate the impact of CAB7 alterations on photosynthetic efficiency

These approaches require careful experimental design with sufficient biological replicates and appropriate statistical methods for data integration. Time-series analyses are particularly valuable for capturing dynamic relationships within the photosynthetic network.

What are common challenges in purifying recombinant CAB7 and how can they be addressed?

Purification of recombinant CAB7 presents several challenges due to its membrane protein nature:

  • Solubility issues:

    • Challenge: CAB7 often aggregates when overexpressed

    • Solution: Screen multiple detergents (mild non-ionic detergents like DDM or DMNG often work best)

    • Alternative: Express as fusion with solubility-enhancing tags (MBP, SUMO)

  • Maintaining native conformation:

    • Challenge: Loss of chlorophyll binding during purification

    • Solution: Include excess chlorophyll during extraction and purification

    • Alternative: Develop purification protocols that preserve pigment-protein interactions

  • Purity assessment:

    • Challenge: Contamination with host cell light-harvesting proteins

    • Solution: Include stringent washing steps in affinity purification

    • Alternative: Implement additional purification steps (ion exchange, size exclusion)

  • Yield optimization:

    • Challenge: Low expression levels or extraction efficiency

    • Solution: Optimize growth conditions and harvest timing

    • Alternative: Scale up production using the most effective Nicotiana varieties (N. tabacum cv. I 64)

Researchers should systematically optimize each purification step, with particular attention to buffer composition, detergent concentration, and temperature. Developing a reliable quality control workflow, including both functional and structural verification, is essential for meaningful downstream experiments.

How can researchers address the challenge of distinguishing CAB7 from other closely related chlorophyll-binding proteins?

Distinguishing CAB7 from related family members requires careful methodological considerations:

  • Antibody-based approaches:

    • Challenge: Cross-reactivity with related proteins

    • Solution: Generate antibodies against unique CAB7 epitopes

    • Alternative: Use epitope tagging for recombinant variants

  • Nucleic acid detection:

    • Challenge: High sequence similarity among CAB family members

    • Solution: Design primers targeting unique regions of CAB7

    • Alternative: Implement highly stringent hybridization conditions

  • Mass spectrometry discrimination:

    • Challenge: Identifying CAB7-specific peptides

    • Solution: Focus on unique peptide sequences for selective multiple reaction monitoring

    • Alternative: Use high-resolution MS techniques with extensive database validation

  • Functional differentiation:

    • Challenge: Overlapping spectroscopic properties

    • Solution: Identify and exploit subtle differences in chlorophyll binding patterns

    • Alternative: Develop CAB7-specific functional assays based on unique properties

Researchers should combine multiple approaches for definitive identification, particularly when studying native protein complexes. Careful validation using recombinant CAB7 as a positive control helps establish the specificity and sensitivity of different detection methods.

What are critical considerations for interpreting phenotypic effects in CAB7 transgenic or mutant plants?

When analyzing phenotypic effects in plants with altered CAB7 expression or function:

  • Pleiotropic effects:

    • Challenge: Distinguishing direct vs. indirect consequences of CAB7 alteration

    • Solution: Include temporal analyses to establish causality

    • Alternative: Create inducible expression systems for controlled activation

  • Compensatory mechanisms:

    • Challenge: Upregulation of related CAB proteins masks phenotypes

    • Solution: Quantify expression of all related family members

    • Alternative: Create multiple knockout lines targeting redundant proteins

  • Environmental dependencies:

    • Challenge: Phenotypes may only manifest under specific conditions

    • Solution: Test multiple environmental parameters (light intensity, quality, temperature)

    • Alternative: Implement field trials to capture natural variation

  • Developmental timing:

    • Challenge: Effects may vary across developmental stages

    • Solution: Conduct comprehensive age-series analyses

    • Alternative: Use stage-specific promoters for temporally controlled expression

Researchers should implement a comprehensive phenotyping approach that includes physiological measurements (photosynthetic parameters, growth metrics), molecular analyses (expression profiles, protein abundance), and ultrastructural studies (chloroplast organization, thylakoid arrangement). When designing transgenic constructs, using the native CAB7 promoter rather than constitutive promoters often provides more physiologically relevant results .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.