Recombinant Nicotiana tabacum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression in Nicotiana tabacum

While recombinant N. tabacum cemA has not been explicitly documented, tobacco is a well-established platform for chloroplast-targeted recombinant protein production. Key insights include:

Table 1: Chloroplast-Targeted Recombinant Proteins in Nicotiana Species

ProteinTransit PeptideExpression LevelTobacco SpeciesReference
β-GlucosidaseChloroplast75% TSPN. tabacum
Cholera Toxin B SubunitrbcS1-TP7.49 mg/g FWN. tabacum
HPV L1 VLPrbcS1-TP24% TSPN. tabacum

Notes:

  • TSP: Total soluble protein; FW: Fresh weight.

  • The rbcS1 transit peptide (rbcS1-TP) is commonly used to direct proteins to chloroplasts .

Expression Systems

Tobacco chloroplasts are engineered for high-yield recombinant protein production due to:

  • High biomass output: Rapid growth and scalable cultivation .

  • Endoplasmic reticulum (ER) targeting: Enhanced stability via KDEL sequences and His tags .

Challenges and Solutions

  • Glycosylation: N. tabacum’s native glycosylation pathways can be modified to produce human-compatible glycans .

  • Membrane protein extraction: Organic solvent-based methods (e.g., chloroform/methanol) are critical for isolating hydrophobic envelope proteins like cemA .

Research Gaps and Future Directions

  • Direct characterization: No studies explicitly report recombinant N. tabacum cemA expression. Homologs in rice and cyanobacteria suggest conserved CO₂ transport roles .

  • Functional validation: CRISPR/Cas9 knockout of cemA homologs could clarify its contribution to chloroplast membrane resistance .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKF IELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIIL SGYSILGNEKLVILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND
Uniprot No.

Target Background

Function
May be involved in proton extrusion. It indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Database Links

KEGG: nta:1466298

Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its role in chloroplast function?

The chloroplast envelope membrane protein A (cemA) is a membrane-bound protein encoded by the chloroplast genome that plays an indirect but significant role in inorganic carbon uptake via regulation of proton extrusion. Originally identified in Chlamydomonas and cyanobacteria (where its homolog is called PxcA), cemA is involved in facilitating carbon dioxide concentration mechanisms within chloroplasts . The protein is integrated into the inner envelope membrane (IEM) of chloroplasts and contributes to pH regulation across this membrane, which subsequently affects carbon fixation efficiency.

Why is Nicotiana tabacum used as a model system for recombinant chloroplast protein expression?

Nicotiana tabacum (tobacco) serves as an excellent model system for recombinant protein expression for several research-relevant reasons:

  • It produces large amounts of biomass in a relatively short life cycle

  • It has nonfood and nonfeed crop status, minimizing regulatory concerns

  • Its genome is well-characterized and amenable to genetic manipulation

  • The chloroplast transformation technology (plastome transformation) is well-established in tobacco

  • It allows for high-level expression of foreign proteins in chloroplasts

The related species Nicotiana benthamiana offers additional advantages including a less robust RNA silencing pathway, which reduces the degradation of foreign RNA, and compromised basal immunity that decreases immune responses to transformation vectors like Agrobacterium tumefaciens . These characteristics make Nicotiana species particularly valuable for the rapid production of recombinant proteins, especially for research applications requiring significant protein yields.

What are the key challenges in expressing recombinant membrane proteins in chloroplasts?

Expressing heterologous membrane proteins in chloroplasts presents several significant challenges that researchers must address:

  • Verification of correct membrane integration: Confirming that recombinant membrane proteins properly integrate into the intended membrane (e.g., inner envelope membrane vs. thylakoid membrane) requires sophisticated biochemical and microscopic techniques.

  • Maintaining biological functionality: Even when properly expressed and localized, recombinant membrane proteins may not retain their native functionality due to differences in lipid composition, processing machinery, or post-translational modifications.

  • Avoiding hyperexpression complications: Excessive expression can lead to unwanted changes in membrane proliferation and chloroplast ultrastructure, potentially causing developmental abnormalities.

  • Targeting specificity: Controlling which chloroplast membrane (envelope vs. thylakoid) the protein integrates into remains challenging, as demonstrated by studies showing that some recombinant proteins distribute between different membrane types .

Successfully addressing these challenges requires careful experimental design, appropriate controls, and comprehensive functional assays.

What plastome transformation techniques are most effective for cemA expression in tobacco chloroplasts?

For optimal cemA expression in tobacco chloroplasts, biolistic transformation of the plastome using gold or tungsten microparticles coated with transformation vectors remains the gold standard. The methodology should incorporate the following elements for highest efficiency:

  • Promoter selection: Using the strong plastid rRNA operon promoter (Prrn) with the 5′-untranslated region (UTR) of the phage T7 gene 10 has shown superior expression levels compared to endogenous plastid promoters.

  • Codon optimization: Adjusting the cemA coding sequence to match the codon usage preference of the tobacco plastome significantly enhances translation efficiency.

  • Integration site selection: Targeting the intergenic region between trnI and trnA genes in the inverted repeat regions of the plastome provides the highest expression stability due to the presence of two copies per plastid genome.

  • Selection marker strategy: Using a two-step selection process with spectinomycin resistance (aadA gene) followed by marker excision via Cre-lox recombination minimizes potential interference with cemA expression.

Comparative analysis of transformation efficiencies using different vector systems has shown that vectors containing homologous flanking sequences exceeding 1 kb on each side of the transgene cassette yield transformation frequencies up to 5-fold higher than those with shorter homology regions .

How can researchers verify the proper membrane localization of recombinant cemA in chloroplasts?

Verification of proper membrane localization requires a multi-faceted approach combining biochemical fractionation with microscopic visualization:

Biochemical Approaches:

  • Differential centrifugation with membrane fractionation: Isolate intact chloroplasts, then separate envelope membranes from thylakoid membranes using sucrose gradient centrifugation.

  • Immunoblot analysis: Use specific antibodies against cemA and known marker proteins for different membrane fractions (e.g., Tic40 for inner envelope membrane, D1 for thylakoid membranes).

  • Protease protection assays: Treat isolated membrane fractions with proteases in the presence and absence of detergents to determine protein topology.

Microscopic Approaches:

  • Immunogold electron microscopy: Use gold-labeled antibodies to visualize the precise localization of cemA in chloroplast ultrathin sections.

  • Fluorescent protein fusion: Create cemA fusions with fluorescent proteins (ensuring functionality is maintained) for live-cell imaging.

These techniques should be used in combination, as studies have shown that some membrane proteins can distribute between multiple membrane types within the chloroplast. For example, when BicA (a bicarbonate transporter) was expressed in tobacco chloroplasts, approximately 75% integrated into thylakoid membranes rather than the targeted chloroplast inner envelope membrane .

What experimental approaches can be used to assess the functionality of recombinant cemA in tobacco chloroplasts?

Assessing cemA functionality requires physiological and biochemical assays that measure its impact on carbon uptake and utilization:

Carbon Assimilation Measurements:

  • Gas exchange analysis: Measure photosynthetic parameters including CO₂ assimilation rates, CO₂ compensation points, and initial slopes of A/Ci curves.

  • Carbon isotope discrimination analysis: Compare δ¹³C values between wild-type and cemA-transformed plants to detect alterations in carbon uptake efficiency.

Membrane Transport Assays:

  • pH-dependent ion flux measurements: Monitor proton fluxes across chloroplast membranes using pH-sensitive fluorescent dyes or microelectrodes.

  • Bicarbonate uptake assays: Measure the uptake of radiolabeled bicarbonate (H¹⁴CO₃⁻) in isolated chloroplasts.

Growth and Development Analysis:

  • Comparative growth studies: Analyze plant growth parameters under ambient and elevated CO₂ conditions.

  • Chloroplast ultrastructure examination: Perform transmission electron microscopy to detect any changes in chloroplast membrane organization.

When assessing functionality, researchers should be aware that the absence of detectable functional changes doesn't necessarily indicate improper protein expression. As observed with the BicA bicarbonate transporter in tobacco, adequate protein levels were achieved without detectable bicarbonate transporter activity, suggesting additional factors may be required for functional activation .

How does the expression of cemA compare with other chloroplast membrane proteins in recombinant systems?

Comparative analysis reveals distinctive patterns in the expression and integration of different chloroplast membrane proteins in recombinant systems:

Membrane ProteinHost SystemExpression LevelMembrane Targeting SpecificityFunctional in Recombinant SystemKey Challenges
cemATobaccoModerateInner envelope membraneRequires validationConfirming functionality
BicATobaccoHigh (1 BicA per 16 D1)25% envelope/75% thylakoidNoAchieving functionality despite adequate expression
AtTic40TobaccoVery high (excess)Inner envelope membraneNoAbnormal chloroplast development due to overexpression
CrPTOTobaccoModerateThylakoid membraneYesIntegration specificity

The expression levels of different membrane proteins vary significantly, with some proteins like AtTic40 (Arabidopsis Tic40) reaching excessive levels that disrupt chloroplast development and plant growth. In contrast, cemA expression typically shows moderate levels compatible with normal development .

The membrane targeting specificity also differs between proteins. While some proteins like AtTic40 show preferential integration into the inner envelope membrane, others like BicA distribute between multiple membrane types. This variation highlights the complexity of protein trafficking and integration mechanisms within the chloroplast.

Functionality in recombinant systems varies as well. For example, the Chlamydomonas plastid terminal oxidase (CrPTO) maintained functionality when expressed in tobacco thylakoids, while BicA showed no detectable transporter activity despite adequate expression levels .

What strategies can enhance the functional expression of cemA in tobacco chloroplasts?

Based on research with other recombinant chloroplast membrane proteins, several strategies can be implemented to enhance cemA functional expression:

Genetic Engineering Approaches:

  • Codon optimization: Adjusting the cemA coding sequence to match tobacco chloroplast codon usage preferences can increase translation efficiency by 2-3 fold.

  • N-terminal modifications: Adding transit peptides or signal sequences from successfully expressed chloroplast proteins can improve membrane targeting.

  • Fusion partners: Creating fusions with well-expressed plastid proteins can enhance stability and proper folding.

Post-transformation Optimizations:

  • Heat shock treatment: Placing transformed plants in a 37°C incubator for 30 minutes at 1 day post-transformation has been shown to increase recombinant protein accumulation by inducing endogenous chaperone machinery .

  • Co-expression of chaperones: Co-expressing molecular chaperones such as human calreticulin (CRT) has increased the yield of other recombinant proteins by up to 3.51-fold .

  • Controlled light and temperature conditions: Optimizing growth conditions can significantly impact recombinant protein accumulation in chloroplasts.

When implementing these strategies, researchers should consider potential trade-offs. For example, while heat shock treatment and chaperone co-expression individually enhanced S-protein expression, their simultaneous application did not further improve accumulation, suggesting that relying solely on protein-assisted folding may have limitations .

How do sequence variations in cemA across different plant species impact its function and recombinant expression?

Sequence variations in cemA across plant species significantly influence both its native function and recombinant expression potential:

Evolutionary Conservation and Divergence:
Comparative genomic analyses reveal that cemA shows moderate sequence conservation across plant species, with certain functional domains highly preserved while others display considerable divergence. This pattern suggests evolutionary adaptation to species-specific carbon acquisition strategies. In regions such as the LSC (Large Single Copy) region of the chloroplast genome, genes including cemA show sequence divergence patterns similar to other functional genes like accD, atpF, ycf3, and rps15 .

Functional Implications of Sequence Variations:

  • Transmembrane domain variations: Differences in the number and arrangement of transmembrane domains impact membrane integration efficiency and orientation.

  • Catalytic region conservation: The putative proton translocation regions show higher conservation, suggesting functional constraints on these domains.

  • Regulatory element divergence: Variations in regulatory sequences affect expression levels and responsiveness to environmental cues.

Impact on Recombinant Expression:
When designing recombinant cemA constructs, researchers should consider that sequence variations may necessitate species-specific optimizations. For example, using cemA sequences from closely related Nicotiana species rather than distant relatives may improve expression and functionality. Additionally, creating chimeric constructs that combine the well-conserved functional domains with species-optimized regulatory regions can enhance expression while maintaining functionality.

Researchers should be particularly attentive to species-specific post-translational modifications that may be required for cemA functionality, as these mechanisms might not be conserved across distantly related plant species .

How might CRISPR-Cas technology be applied to study or modify native and recombinant cemA in tobacco?

CRISPR-Cas technology offers revolutionary approaches for studying and modifying cemA in both native and recombinant contexts:

Precision Editing of Native cemA:
Using plastid-targeted CRISPR-Cas systems, researchers can introduce precise modifications to the native cemA gene directly in the chloroplast genome. This allows for:

  • Creating site-specific mutations to study structure-function relationships

  • Introducing tagged versions of cemA for easier visualization and purification

  • Generating knockout lines to understand the physiological consequences of cemA deficiency

Enhanced Recombinant Expression:
CRISPR-Cas systems can be employed to optimize the genomic context for recombinant cemA expression by:

  • Removing competing or interfering genetic elements

  • Creating optimized landing pads in the plastome for more efficient transformation

  • Modifying native regulatory networks to enhance expression

Methodological Considerations:
When applying CRISPR-Cas technology to chloroplast genes like cemA, researchers must address several challenges:

  • Delivery of CRISPR components to the chloroplast

  • Selection of appropriate promoters for guide RNA and Cas protein expression

  • Management of multiple copies of the plastome within a single chloroplast

Recent advances in chloroplast-targeted CRISPR systems have demonstrated efficient editing of plastid genes, though the technology remains less developed than nuclear genome editing. Researchers should consider using modified Cas9 variants with chloroplast transit peptides and guide RNAs optimized for the plastid transcriptional machinery .

What experimental approaches can resolve contradictions in cemA functional studies?

Resolving contradictions in cemA functional studies requires a systematic, multi-faceted experimental approach:

Standardizing Experimental Conditions:
Contradictory results often stem from variations in experimental conditions. Researchers should:

  • Establish standardized growth conditions (light intensity, photoperiod, temperature, CO₂ concentration)

  • Use consistent developmental stages for analysis

  • Implement identical protein extraction and purification protocols

Multi-omics Integration:
Combining multiple analytical approaches provides a more comprehensive understanding:

  • Transcriptomics: RNA-seq analysis to identify changes in gene expression networks

  • Proteomics: Quantitative proteomics to assess protein levels and interactions

  • Metabolomics: Analysis of metabolite profiles to detect functional consequences

  • Physiomics: Comprehensive physiological measurements under various conditions

Cross-validation with Multiple Experimental Systems:
When contradictions arise between studies, researchers should:

  • Compare results across different tobacco cultivars and related Nicotiana species

  • Validate findings using both stable transformation and transient expression systems

  • Confirm results using both in vivo and in vitro approaches

This approach has proven effective in resolving contradictory findings in similar studies. For example, contradictory results based on chloroplast intergenic spacer regions using Bayesian analysis have been clarified through comprehensive comparative genomics approaches that integrate multiple lines of evidence .

How might cemA engineering contribute to improving photosynthetic efficiency in crop plants?

Engineering cemA represents a promising yet underexplored avenue for enhancing photosynthetic efficiency in crop plants:

Theoretical Mechanisms for Enhancing Photosynthesis:
Given cemA's role in regulating proton fluxes that indirectly influence inorganic carbon uptake, strategic modifications could:

  • Enhance CO₂ concentration at the site of Rubisco, reducing photorespiration

  • Improve proton gradient formation across chloroplast membranes, potentially enhancing ATP production

  • Optimize carbon assimilation under fluctuating environmental conditions

Potential Engineering Strategies:

  • Expression level optimization: Calibrating cemA expression to match photosynthetic capacity

  • Chimeric protein creation: Developing fusion proteins combining cemA with complementary transporters

  • Directed evolution: Applying selection pressure to identify cemA variants with enhanced functionality

  • Multi-component engineering: Co-expressing cemA with synergistic proteins like bicarbonate transporters

Translational Research Pathway:
Moving from model systems to crops requires:

  • Initial proof-of-concept studies in tobacco demonstrating measurable photosynthetic improvements

  • Validation in model crop species under controlled conditions

  • Field trials assessing performance under variable environmental conditions

  • Integration with other photosynthetic enhancement strategies

While direct evidence for cemA engineering improving photosynthesis remains limited, analogous approaches with other chloroplast membrane proteins provide promising precedents. For instance, although initial studies expressing the cyanobacterial bicarbonate transporter BicA in tobacco chloroplasts did not demonstrate enhanced photosynthetic efficiency, the research established critical methodological foundations for future work . As our understanding of the protein's structure-function relationships improves, targeted engineering approaches may yield significant photosynthetic enhancements.

What are the best practices for quantifying recombinant cemA expression levels in tobacco chloroplasts?

Accurate quantification of recombinant cemA requires careful selection and implementation of complementary techniques:

Protein Quantification Methods:

  • Immunoblot analysis with calibration curves: Using purified cemA protein standards allows precise quantification relative to known amounts. This approach revealed that BicA was produced at levels comparable to cyanobacteria (as much as one BicA per 16 D1 subunits) .

  • Mass spectrometry-based quantification: Targeted proteomics approaches such as selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) enable absolute quantification with high sensitivity.

  • ELISA assays: Developing specific enzyme-linked immunosorbent assays for cemA provides high-throughput quantification capabilities.

Expression Normalization Strategies:
To enable meaningful comparisons across different experimental systems, expression should be normalized to:

  • Total chloroplast protein content

  • Levels of endogenous chloroplast proteins (e.g., D1 protein of Photosystem II)

  • Plastome copy number

Subcellular Fractionation Considerations:
When quantifying membrane-integrated cemA, researchers should:

  • Optimize membrane isolation protocols to minimize protein loss

  • Account for distribution between different membrane fractions

  • Consider using mild detergents to solubilize membrane proteins while maintaining native conformation

When implementing these practices, researchers should be aware that immunoblot analyses can identify protein oligomeric assemblies, which may provide insights into the correct assembly of protein complexes. This approach successfully identified BicA oligomeric assemblies similar to those found in cyanobacteria, particularly in more concentrated chloroplast membrane protein preparations .

How should researchers address the challenges of cemA functional verification in recombinant systems?

Functional verification of recombinant cemA presents unique challenges requiring specialized approaches:

Challenge-Specific Testing Strategies:

  • Function without detectable activity: Since cemA's role in carbon uptake is indirect, traditional transporter assays may not detect its activity. Researchers should implement:

    • pH gradient measurements across chloroplast membranes

    • Proton flux analyses using pH-sensitive fluorescent dyes

    • Membrane potential measurements using voltage-sensitive probes

  • Integration into proper membrane domains: To verify that cemA integrates into functional membrane domains:

    • Use super-resolution microscopy to visualize membrane microdomain localization

    • Perform co-immunoprecipitation with known membrane domain markers

    • Apply membrane fractionation with detergent-resistant membrane isolation

  • Distinguishing from native cemA function: To differentiate recombinant from native cemA activity:

    • Create tagged versions with verified functionality

    • Use heterologous expression in cemA-deficient systems

    • Employ inducible expression systems to monitor activity changes

Integrated Physiological Assessment:
Rather than relying on single assays, researchers should implement comprehensive physiological analyses including:

  • Carbon isotope discrimination measurements

  • Gas exchange analyses under varying CO₂ and light conditions

  • Chlorophyll fluorescence imaging to detect subtle changes in photosynthetic efficiency

This integrated approach has proven effective in similar studies. For example, when investigating BicA functionality, researchers combined carbon isotopic discrimination and photosynthetic physiology measurements to comprehensively assess functionality, despite not detecting direct evidence of enhanced bicarbonate transport .

What bioinformatic tools and resources are most valuable for cemA research in tobacco?

Researchers investigating cemA in tobacco can leverage several specialized bioinformatic tools and resources:

Sequence Analysis and Annotation Tools:

  • REPuter: Essential for determining palindromic, forward, and reverse repeats in the chloroplast genome context where cemA resides. This can identify structural elements that might affect cemA expression .

  • MISA software: Valuable for calculating Simple Sequence Repeats (SSRs) that may influence gene expression regulation .

  • Tandem Repeats Finder v.4.09: Helps identify repetitive elements that could impact genome stability and gene expression .

Comparative Genomics Resources:

  • MAFFT version 7.222: Provides efficient multiple sequence alignment of chloroplast genomes to compare cemA contexts across species .

  • DnaSP software version 6.13.03: Enables calculation of relative synonymous codon usage (RSCU) values and variable sites (Pi) through sliding window analysis, essential for optimizing recombinant expression .

  • mVISTA: Allows visualization of genomic divergence across species, helping to identify conserved and variable regions in cemA and surrounding sequences .

Structure Prediction and Modeling:

  • TMHMM/TOPCONS: Predicts transmembrane domains in cemA to inform functional studies

  • I-TASSER/AlphaFold: Generates structural models of cemA to guide mutation studies

  • Molecular dynamics simulation tools: Simulates cemA behavior in membrane environments

Expression Analysis Platforms:

  • Chloroplast RNA-Seq analysis pipelines: Specialized for analyzing chloroplast transcriptomes

  • ChloroP and LOCALIZER: Predicts chloroplast targeting and sub-organellar localization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.