Recombinant Nicotiana tabacum Cytochrome b5

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Cytochrome b5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Protein Sequence
MGGETKVFTLAEVSQHNNAKDCWLVISGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFE DVGHSSSARAMLDEYYVGDIDSATIPTKTKYTPPNQPHYNQDKTSEFVVKLLQFLVPLII LGVAFGIRFYTKQSSA
Uniprot No.

Target Background

Function

Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for various membrane-bound oxygenases. It plays a crucial role in fatty acid desaturation modification within the endoplasmic reticulum. In developing seeds, this function is essential for membrane synthesis and the regulated production of storage lipids. Furthermore, Cytochrome b5 is involved in cytochrome P-450 reduction, potentially contributing to flavonoid biosynthesis in petals.

Database Links

KEGG: nta:107781159

UniGene: Nta.4171

Protein Families
Cytochrome b5 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side. Microsome membrane; Single-pass membrane protein; Cytoplasmic side.
Tissue Specificity
Is highly expressed in developing seeds, moderately expressed in flowers, and is expressed at low levels in the leaf.

Q&A

What are the key characteristics of recombinant Nicotiana tabacum cytochrome b5 expressed in E. coli?

Recombinant tobacco cytochrome b5 expressed in E. coli using a T7 polymerase/promoter system displays several distinctive characteristics. The transformed cells exhibit a red coloration and accumulate cytochrome b5 to approximately 30% of the total cell protein . The purified recombinant protein demonstrates oxidized, reduced, and low-temperature absorbance spectra that are characteristic of plant microsomal cytochrome b5, as well as a circular dichroism spectrum resembling that of mammalian cytochrome b5 . Importantly, the recombinant protein is correctly assembled and biologically active, capable of being reduced by NADH in the presence of microsomal membranes prepared from developing seeds of sunflower (Helianthus annuus) .

How many distinct forms of cytochrome b5 exist in tobacco plants and how do they differ functionally?

Research has identified at least two distinct forms of cytochrome b5 in tobacco (Nicotiana tabacum L.). The first form was previously characterized by Smith et al. (1994), while a second form was later isolated from developing seeds . These two forms differ in their sequence characteristics and, more significantly, in their expression patterns. Through Northern blotting and RNase protection assays of RNA samples from different tobacco tissues, researchers determined that the second cytochrome b5 form is expressed exclusively in developing seeds . This tissue-specific expression suggests specialized functional roles, with the seed-specific form potentially involved in seed-specific metabolism, such as fatty acid modification during seed development.

Cytochrome b5 FormExpression PatternIsolation MethodPotential Function
Form 1Broader tissue distributionStandard isolationGeneral cellular metabolism
Form 2Exclusively in developing seedsPCR from seed cDNA followed by RACE-PCRSeed-specific metabolism

What expression system provides optimal yield and activity for recombinant tobacco cytochrome b5?

The T7 polymerase/promoter system in E. coli, as described by Studier, Rosenberg, Dunn, and Dubendorff (1990), has proven highly effective for expressing tobacco cytochrome b5 . This system enables accumulation of the protein to approximately 30% of total cell protein, making it ideal for large-scale production and purification . The high-level expression is visually indicated by the red coloration of transformed cells, confirming successful incorporation of the heme group . The recombinant protein expressed in this system maintains the biochemical and spectral characteristics of native plant cytochrome b5 and retains full biological activity, as demonstrated by its ability to participate in NADH-dependent reduction reactions .

How does heme synthesis affect the assembly of recombinant cytochrome b5 holoprotein?

The assembly of functional cytochrome b5 holoprotein in E. coli depends critically on heme synthesis. Research has shown that inhibition of heme synthesis in transformed E. coli cells expressing cytochrome b5, through the use of inhibitors such as gabaculin or succinylacetone, prevents the assembly of the cytochrome b5 holoprotein . Interestingly, these inhibitors have little effect on the accumulation of the cytochrome apoprotein (the protein without the heme group) . This finding demonstrates that while the expression of the protein backbone proceeds normally, the incorporation of the heme group—essential for creating the functional holoprotein—is dependent on the cell's capacity for heme synthesis. This insight is particularly valuable for researchers seeking to optimize production systems for functional recombinant cytochrome b5.

What spectroscopic methods are most effective for analyzing the structure and function of recombinant tobacco cytochrome b5?

Multiple spectroscopic techniques provide complementary insights into the structural integrity and functional status of recombinant tobacco cytochrome b5:

Spectroscopic MethodInformation ProvidedResearch Significance
Oxidized absorbance spectraConfirms proper heme incorporationValidates structural integrity
Reduced absorbance spectraIndicates electron-accepting capacityConfirms functional potential
Low-temperature absorbance spectraReveals fine spectral featuresAllows detailed structural analysis
Circular dichroism (c.d.) spectroscopyShows secondary structure elementsEnables comparison with homologs

These techniques collectively confirm that recombinant tobacco cytochrome b5 expressed in E. coli possesses spectral characteristics typical of plant microsomal cytochrome b5, with the c.d. spectrum resembling that of mammalian cytochrome b5 . This spectroscopic profile serves as an essential quality control measure for researchers producing the recombinant protein.

How can researchers assess the biological activity of recombinant tobacco cytochrome b5?

The biological activity of recombinant tobacco cytochrome b5 can be assessed through several methodological approaches:

  • NADH-dependent reduction: Measure the protein's ability to accept electrons when incubated with NADH in the presence of microsomal membranes from developing seeds (e.g., sunflower) .

  • Enzyme coupled assays: NADH:cytochrome b5 reductase enzyme activity can be quantified by measuring Fe3+-citrate reductase activity, as described by Bagnaresi et al. . This typically involves monitoring product formation continuously at room temperature in an assay containing the recombinant protein and appropriate substrates.

  • Spectrophotometric monitoring: Track changes in absorbance spectra that correspond to the transition between oxidized and reduced forms of the cytochrome.

  • Integration with reconstituted systems: Evaluate the protein's function within reconstituted electron transport chains involving other components such as NADH:cytochrome b5 reductase.

These approaches provide robust verification that the recombinant protein maintains its native electron transfer capabilities and is suitable for downstream applications.

What methods are most effective for determining the subcellular localization of cytochrome b5 in plant cells?

Researchers have employed sophisticated techniques to investigate the subcellular localization of cytochrome b5 in plant cells:

  • Epitope tagging and transient expression: Myc-epitope-tagged versions of cytochrome b5 proteins are transiently expressed in tobacco (Nicotiana tabacum cv. Bright Yellow 2) suspension-cultured cells through biolistic bombardment .

  • Immunofluorescence microscopy: Following fixation with formaldehyde and permeabilization with pectolyase Y-23 and Triton X-100, cells are processed for indirect immunofluorescence microscopy. This allows visualization of the tagged proteins and comparison with endogenous organelle markers .

  • Differential permeabilization: To determine topological orientation, researchers use digitonin (25 μg/ml) rather than Triton X-100 to selectively permeabilize the plasma membrane while leaving organelle membranes intact .

  • Advanced imaging and analysis: Images are captured using epifluorescence microscopy with high-resolution objectives and CCD cameras, then processed with deconvolution software to enhance detail and clarity .

These approaches have revealed that some cytochrome b5 isoforms target to the endoplasmic reticulum while others specifically localize to other compartments such as the outer membrane of mitochondria , highlighting the diverse subcellular distribution of cytochrome b5 variants.

How do structural features of cytochrome b5 determine its targeting to specific subcellular compartments?

The subcellular targeting of cytochrome b5 isoforms depends on specific structural features, particularly in their C-terminal regions. Research has shown that:

  • Different isoforms of cytochrome b5 show distinct targeting preferences, with some localizing to the endoplasmic reticulum while others target to mitochondrial outer membranes .

  • The C-terminal region contains the membrane-anchoring domain and targeting information that directs the protein to specific subcellular compartments .

  • In plants, unlike mammalian systems, the endoplasmic reticulum can accommodate cytochromes with opposite C-terminal net charge, suggesting unique features of plant protein targeting mechanisms .

  • The specific amino acid composition, hydrophobicity, and charge distribution in the tail anchor region play critical roles in determining the final localization of different cytochrome b5 isoforms .

Understanding these targeting mechanisms provides insights into the evolution of protein sorting in plants and has implications for biotechnological applications involving engineered proteins with specific subcellular destinations.

How can recombinant tobacco cytochrome b5 be integrated into studies of plant microsomal oxidation-reduction pathways?

Recombinant tobacco cytochrome b5 serves as a powerful tool for investigating plant microsomal oxidation-reduction pathways through several methodological approaches:

  • Reconstitution experiments: The purified recombinant protein can be incorporated into artificial membrane systems along with other components of electron transfer chains to study pathway kinetics and regulation under controlled conditions .

  • Protein-protein interaction studies: The recombinant protein can be used to identify and characterize interactions with partners such as NADH:cytochrome b5 reductase and various cytochrome P450 enzymes .

  • Functional complementation: Expression of the recombinant protein in systems deficient in native cytochrome b5 can help establish the specific roles of this protein in different metabolic pathways .

  • Structure-function analysis: Site-directed mutagenesis of the recombinant protein allows researchers to investigate how specific residues contribute to electron transfer efficiency and partner protein interactions .

These approaches enable detailed mechanistic studies of electron transfer processes involved in various plant metabolic pathways, including fatty acid desaturation, sterol biosynthesis, and cytochrome P450-dependent reactions.

What role does cytochrome b5 play in nicotine metabolism and alkaloid biosynthesis in tobacco?

Cytochrome b5 plays crucial roles in nicotine metabolism and alkaloid biosynthesis in tobacco, particularly through its interactions with cytochrome P450 enzymes:

  • Nicotine demethylation: Cytochrome b5 serves as an electron donor in reactions catalyzed by cytochrome P450 enzymes that demethylate nicotine to form nornicotine, a precursor to the nitrosamine N'-nitrosonornicotine (NNN) .

  • Cytochrome P450 enhancement: The presence of cytochrome b5 significantly enhances the activity of specific CYP enzymes involved in alkaloid metabolism, such as CYP82E4, which mediates the conversion of nicotine to nornicotine in tobacco .

  • Tissue-specific roles: The seed-specific form of cytochrome b5 may have specialized functions in alkaloid metabolism during seed development .

  • NADPH dependency: The microsomal demethylase activity involved in nicotine metabolism requires molecular oxygen and NADPH for full activity, with cytochrome b5 facilitating electron transfer in this system .

Understanding these relationships is particularly important for research aimed at modifying alkaloid content in tobacco plants, either for reduced toxicity in tobacco products or for biotechnological production of valuable secondary metabolites.

How does tobacco cytochrome b5 compare structurally and functionally to cytochrome b5 proteins from other plants and organisms?

Comparative analysis reveals both conserved features and unique aspects of tobacco cytochrome b5:

OrganismStructural SimilaritiesFunctional DifferencesEvolutionary Implications
Tobacco vs. MammalianSimilar c.d. spectrum Plant-specific functions in fatty acid metabolismFundamental conservation of electron transfer mechanism
Tobacco vs. Other PlantsConserved catalytic domainsTissue-specific expression patternsAdaptive specialization in Solanaceae
Seed-specific vs. General FormShared heme-binding domainDifferent expression patterns and potential rolesGene duplication and functional divergence

What evidence suggests that cytochrome b5 fusion proteins represent an evolutionary adaptation in plants?

Research indicates that certain cytochrome b5 fusion proteins represent important evolutionary adaptations in plants:

  • Novel fusion proteins: A class of cytochrome b5 fusion proteins has been identified, suggesting evolutionary recombination of enzymes with an ancestral haemoprotein .

  • Functional integration: These fusion proteins integrate the electron transfer function of cytochrome b5 with catalytic domains, creating efficient metabolic modules.

  • Tissue-specific expression: The identification of a seed-specific cytochrome b5 in tobacco suggests evolutionary adaptation to specialized metabolic requirements during seed development .

  • Structural conservation with functional diversification: The maintenance of core structural features while developing specialized functions points to adaptive evolution through gene duplication followed by subfunctionalization.

This evolutionary perspective provides insight into how plants have adapted electron transfer systems to meet the specific demands of plant metabolism, tissue development, and environmental responses through the diversification of cytochrome b5 proteins.

What are the primary challenges in expressing and purifying functional recombinant tobacco cytochrome b5?

Researchers face several methodological challenges when working with recombinant tobacco cytochrome b5:

  • Heme incorporation: Ensuring proper incorporation of the heme group is critical for functional protein. Research has shown that inhibition of heme synthesis prevents assembly of the holoprotein , indicating the importance of optimizing conditions for heme availability.

  • Protein solubility: As a membrane-associated protein, cytochrome b5 can present solubility challenges during expression and purification.

  • Post-translational modifications: Ensuring that recombinant systems provide necessary post-translational modifications for full functionality.

  • Functional verification: Confirming that the recombinant protein maintains native electron transfer capabilities requires specialized assays and equipment.

These challenges can be addressed through careful optimization of expression systems, such as the T7 polymerase/promoter system in E. coli that has successfully produced high yields (approximately 30% of total cell protein) of functional tobacco cytochrome b5 .

How can researchers effectively distinguish between the activities of different cytochrome b5 isoforms in complex plant systems?

Distinguishing between the activities of different cytochrome b5 isoforms in plant systems requires sophisticated methodological approaches:

  • Isoform-specific antibodies: Development of antibodies that specifically recognize different cytochrome b5 isoforms allows for selective detection in complex protein mixtures.

  • Tissue-specific expression analysis: Techniques such as Northern blotting, RNase protection assays, and RT-PCR can identify tissues where specific isoforms are preferentially expressed .

  • Recombinant expression of individual isoforms: Expressing each isoform individually in heterologous systems allows characterization of their specific activities and properties.

  • Genetic approaches: Knockout or knockdown of specific isoforms in planta, followed by phenotypic and biochemical analysis, can reveal their non-redundant functions.

  • Mass spectrometry-based proteomics: Advanced proteomic approaches can identify and quantify specific isoforms in different tissues and subcellular fractions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.