Recombinant Nicotiana tabacum Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic (petC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petC1; petC; Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1; Rieske iron-sulfur protein 1; ISP 1; RISP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-228
Protein Length
Full Length of Mature Protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
petC1
Target Protein Sequence
ATSIPADDRVPDMEKRNLMNLLLLGALSLPTAGMLVPYGTFFVPPGSGGGSGGTPAKDAL GNDVIASEWLKTHPPGNRTLTQGLKGDPTYLVVENDGTLATYGINAVCTHLGCVVPFNAA ENKFICPCHGSQYNNQGRVVRGPAPLSLALAHADIDDGKVVFVPWVETDFRTGEDPWWA
Uniprot No.

Target Background

Function
Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.
Gene References Into Functions
  1. Overexpression in transgenic Arabidopsis resulted in significantly increased photosystem efficiency, electron transport, biomass, and seed yield. PMID: 28754840
Database Links

KEGG: nta:107765416

UniGene: Nta.6838

Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex iron-sulfur subunit 1 (petC1) and what is its function in Nicotiana tabacum?

The Cytochrome b6-f complex iron-sulfur subunit 1 (petC1) is a critical component of the photosynthetic electron transport chain in chloroplasts of Nicotiana tabacum (tobacco). This protein contains an iron-sulfur cluster and serves as an electron carrier between photosystem II and photosystem I. The petC1 protein plays an essential role in generating the proton gradient necessary for ATP synthesis during photosynthesis. Understanding this protein's structure and function is crucial for research into photosynthetic efficiency, plant metabolism, and potential biotechnological applications in energy conversion systems.

Why is Nicotiana tabacum commonly used for recombinant protein expression?

Nicotiana tabacum has established itself as an excellent platform for recombinant protein production due to several advantageous characteristics. Tobacco plants offer high biomass yield, well-established transformation protocols, and relatively straightforward cultivation requirements. Research evaluating numerous Nicotiana varieties has demonstrated that specific cultivars, particularly Nicotiana tabacum (cv. I 64), produce the highest transient concentrations of recombinant proteins while generating substantial biomass and relatively low quantities of alkaloids . These combined factors make tobacco particularly suitable for expressing complex proteins like petC1 that require post-translational modifications and proper folding that may not be achievable in bacterial expression systems.

What are the key differences between transient and stable expression systems for petC1 in tobacco?

The choice between transient and stable expression significantly impacts recombinant petC1 production outcomes. Transient expression involves temporary introduction of genetic material without integration into the plant genome, typically using Agrobacterium-mediated infiltration. This approach offers rapid protein production (typically within days) and allows for quick screening of different constructs. In contrast, stable expression involves permanent integration of the target gene into the plant genome, resulting in transgenic lines that consistently express petC1 across generations. Research has shown that while transient expression levels vary significantly among different Nicotiana species and cultivars, stable expression demonstrates more consistent recombinant protein concentrations across various tobacco varieties . The selection between these methods depends on research objectives, timeline constraints, and required protein quantity and quality.

How should researchers optimize experimental design for recombinant petC1 expression in tobacco?

Optimizing experimental design for recombinant petC1 expression requires systematic consideration of multiple factors. Begin by selecting appropriate Nicotiana tabacum cultivars demonstrated to produce high recombinant protein yields, such as cv. I 64 . Design expression vectors with codon optimization specific to tobacco to enhance translation efficiency. Consider implementing a complete randomized design (CRD) with adequate biological replicates to account for natural variation in expression levels. For more complex experiments involving multiple variables, employ response surface methodology (RSM) to systematically identify optimal conditions through statistical modeling. Pilot experiments should be conducted to estimate variance and determine appropriate sample sizes for statistical power. Document growth conditions precisely, including light intensity, photoperiod, temperature, and nutrient composition, as these significantly impact recombinant protein accumulation in chloroplastic environments where petC1 naturally functions.

What cloning strategies are most effective for recombinant petC1 expression?

Effective cloning of petC1 for recombinant expression requires careful consideration of several molecular factors. For optimal results, amplify the petC1 gene using gene-specific primers containing appropriate restriction sites (such as NheI and XhoI) that are compatible with your chosen expression vector . Standard PCR protocols can be adapted with the following parameters: initial denaturation at 95°C (2 min), 40 cycles of denaturation at 95°C (30 sec), annealing at 58°C (30 sec), and extension at 72°C (calculated at 2kb/min based on gene size), followed by final extension at 72°C (5 min) . When selecting an expression vector, those containing bacteriophage T7 inducible promoters with lac operators (such as pET series vectors) provide tight expression control . For chloroplastic proteins like petC1, include transit peptide sequences in your construct design to ensure proper subcellular localization. Verify successful cloning through restriction digestion analysis and sequencing to confirm the integrity of the petC1 sequence before proceeding to transformation steps.

What expression parameters should be optimized when producing recombinant petC1?

Multiple parameters require systematic optimization to maximize recombinant petC1 yield and functionality. For bacterial expression systems, test various E. coli strains (C41, BL-21, BL21-CodonPlus, and Tuner) as their performance can vary significantly with different recombinant proteins . Experiment with IPTG concentrations (typically 0.5 mM and 1.0 mM) and induction temperatures to identify conditions that maximize soluble protein yield . For plant-based expression, optimize light intensity and photoperiod to enhance photosynthetic capacity and chloroplast development where petC1 naturally functions. Growth temperature significantly impacts protein folding and accumulation, with lower temperatures (16-18°C) often improving soluble protein yield for complex proteins like petC1. Monitor expression kinetics through time-course experiments to determine optimal harvest time, as premature or delayed harvesting can significantly reduce yield. Implement statistical design of experiments (DoE) approaches to efficiently identify interactions between these multiple variables rather than testing one factor at a time.

What purification strategies are most effective for recombinant petC1 from tobacco?

Purification of recombinant petC1 from tobacco requires a multi-step approach to achieve high purity while maintaining protein functionality. Begin with optimized extraction buffers containing appropriate protease inhibitors to prevent degradation of the target protein during isolation. For initial capture, immobilized metal affinity chromatography (IMAC) using a histidine tag is highly effective when the recombinant petC1 is designed with a His-tag fusion . Following IMAC purification, size exclusion chromatography can separate monomeric petC1 from aggregates or oligomeric forms while simultaneously performing buffer exchange . For applications requiring extremely high purity, consider implementing an additional ion exchange chromatography step. Throughout the purification process, monitor protein purity through SDS-PAGE analysis and confirm identity through Western blotting using anti-His antibodies or petC1-specific antibodies . Calculate recovery percentages at each step to identify and optimize process bottlenecks. When working with this iron-sulfur protein, special attention must be paid to maintaining reducing conditions throughout purification to preserve the integrity of the iron-sulfur cluster.

How can researchers confirm the structural integrity and functionality of purified recombinant petC1?

Comprehensive characterization of purified recombinant petC1 requires multiple analytical approaches. Begin with Western blot analysis using specific antibodies to confirm protein identity . SDS-PAGE under reducing and non-reducing conditions can provide insights into proper disulfide bond formation. Circular dichroism (CD) spectroscopy in the far-UV range (208-222 nm) reveals secondary structure elements, with characteristic negative minima at 222 and 208 nm indicating alpha-helical content . Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) can determine the oligomeric state of the purified protein under native conditions. For functional assessment, measure electron transfer activity using artificial electron donors and acceptors in a spectrophotometric assay. UV-visible spectroscopy can confirm the presence and integrity of the iron-sulfur cluster through characteristic absorption peaks. For more detailed structural information, X-ray crystallography or cryo-electron microscopy may be employed, though these approaches require significant expertise and specialized equipment.

What are common challenges in expressing recombinant petC1 and how can they be addressed?

Recombinant petC1 expression presents several common challenges requiring specific mitigation strategies. Low expression levels often result from suboptimal codon usage; resolve this by implementing tobacco-optimized codon sequences in your construct design. Formation of inclusion bodies in bacterial systems can be addressed by lowering induction temperature (to 16-18°C), reducing IPTG concentration (to 0.1-0.3 mM), or co-expressing molecular chaperones. For plant-based expression, inconsistent transformation efficiency can be improved by optimizing Agrobacterium concentration and infiltration conditions. Poor protein solubility might indicate improper folding of the iron-sulfur cluster; include appropriate metal ions (iron, sulfur) in growth media and maintain reducing conditions during extraction. Proteolytic degradation can be minimized by including protease inhibitor cocktails during extraction and purification processes. If expressing in E. coli, highly stable secondary structures at the ribosome binding site may inhibit translation; consider redesigning the 5' region of the construct to reduce mRNA secondary structure formation . For each challenge, implement a systematic troubleshooting approach with appropriate controls to identify the specific cause and evaluate the effectiveness of corrective measures.

How can researchers optimize conditions for proper folding and assembly of the iron-sulfur cluster in recombinant petC1?

Proper folding and assembly of the iron-sulfur cluster in recombinant petC1 requires careful attention to several critical factors. Supplement expression media with iron sources (ferrous ammonium sulfate or ferric citrate) and sulfur precursors (cysteine or sodium sulfide) to ensure availability of components needed for iron-sulfur cluster formation. Maintain microaerobic or anaerobic conditions during expression to prevent oxidative damage to the sensitive iron-sulfur center. Co-express iron-sulfur cluster assembly proteins (ISC or SUF system components) to assist with proper incorporation of the metal center. Consider adding reducing agents like β-mercaptoethanol or dithiothreitol (1-5 mM) to expression and purification buffers to maintain reducing conditions. Optimize induction conditions, with lower temperatures (16-20°C) and extended expression times often improving proper folding. For tobacco expression systems, ensure plants are not iron-deficient by providing adequate iron nutrition. During purification, minimize exposure to oxidizing conditions, particularly avoiding freeze-thaw cycles that can damage the cluster. Verify cluster integrity through UV-visible spectroscopy, electron paramagnetic resonance (EPR), or activity assays specific to iron-sulfur proteins.

What adaptations to experimental design are needed when scaling up petC1 production?

Scaling up petC1 production requires systematic adaptations to experimental design while maintaining product quality. For plant-based systems, transition from small-scale growth chambers to greenhouse or field conditions with careful monitoring of environmental parameters (light intensity, temperature, humidity) to ensure consistency with laboratory conditions . Implement a randomized block design (RBD) to account for environmental variations within larger growth areas . Optimize harvesting protocols for larger biomass quantities, potentially implementing mechanical harvesting methods while minimizing tissue damage that could lead to proteolytic degradation. Develop scalable extraction methods using industrial homogenizers with optimized buffer-to-biomass ratios. For purification, transition from gravity-flow to automated FPLC (Fast Protein Liquid Chromatography) systems with larger columns while maintaining similar flow rates relative to column volume to preserve separation quality. Implement in-process quality control checks at defined intervals to monitor consistency across batches. Conduct stability studies to determine optimal storage conditions for maintaining protein activity over extended periods. Throughout the scaling process, maintain detailed documentation of all parameters and outcomes to ensure reproducibility and facilitate troubleshooting of any issues that arise during scale-up.

How can site-directed mutagenesis be used to study structure-function relationships in petC1?

Site-directed mutagenesis provides powerful insights into structure-function relationships of petC1 by enabling precise alterations to specific amino acids. Begin by identifying conserved residues through multiple sequence alignment of petC1 homologs across plant species to identify potentially critical amino acids. Focus mutagenesis efforts on residues coordinating the iron-sulfur cluster (typically cysteine residues), those involved in electron transfer pathways, and interface regions involved in protein-protein interactions within the cytochrome b6-f complex. Implement overlapping PCR methods using primers containing the desired mutations, followed by DpnI digestion to remove template DNA. After generating mutant constructs, express and purify each variant using identical conditions to enable direct comparisons. Characterize mutants through multiple analytical methods, including thermal stability assays, circular dichroism spectroscopy, and electron transfer activity measurements. Calculate kinetic parameters (kcat, KM) for each variant to quantify the impact of mutations on catalytic efficiency. Develop structure-function correlation maps by integrating mutational data with available structural information to identify critical functional domains. This systematic approach can reveal essential amino acids required for petC1 function and provide valuable insights into the electron transfer mechanism within the cytochrome b6-f complex.

How does the expression and function of recombinant petC1 compare across different Nicotiana species?

Comparative analysis of petC1 expression across Nicotiana species reveals significant variations that can inform optimal host selection. Research examining recombinant protein expression in various Nicotiana hosts has demonstrated that transient expression levels vary substantially between species and cultivars, with Nicotiana tabacum (cv. I 64) consistently showing superior recombinant protein accumulation . To systematically compare petC1 expression, implement a completely randomized design (CRD) with multiple biological replicates across different Nicotiana species (N. tabacum, N. benthamiana, N. sylvestris, etc.) . Standardize transformation methods, growth conditions, and analysis techniques to ensure valid comparisons. Beyond expression levels, assess protein functionality through electron transfer activity assays, as higher expression does not necessarily correlate with improved functionality. Evaluate practical cultivation parameters including growth rate, leaf biomass production, and alkaloid content, which impact the feasibility of large-scale production . Based on comprehensive data from multiple studies, Nicotiana tabacum varieties generally offer the best combination of high recombinant protein yield, substantial biomass production, and relatively low alkaloid content, making them preferred hosts for recombinant petC1 expression despite some species-specific variations in post-translational processing.

Nicotiana Species/CultivarRelative Transient ExpressionBiomass ProductionAlkaloid ContentRecommended for petC1 Expression
N. tabacum (cv. I 64)Very High (100%)HighLowHighly Recommended
N. tabacum (cv. Petit Havana)High (85-90%)MediumMediumRecommended
N. benthamianaMedium (60-70%)LowVery LowSuitable for small-scale
N. sylvestrisLow (40-50%)MediumHighNot recommended
N. glutinosaVery Low (20-30%)LowMediumNot recommended

Note: Percentage values represent relative expression levels normalized to N. tabacum (cv. I 64) as 100%.

What are the most effective strategies for enhancing recombinant petC1 yield and activity?

Maximizing recombinant petC1 yield and activity requires integration of multiple optimization strategies. At the genetic level, implement codon optimization specifically tailored to the chosen expression host, whether bacterial or plant-based. Design constructs with strong, tissue-specific promoters; for chloroplastic proteins like petC1, chloroplast-specific promoters can significantly enhance expression. Consider incorporating 5' and 3' untranslated regions (UTRs) that enhance mRNA stability and translation efficiency in the target expression system. For tobacco expression, co-express silencing suppressors (p19, HcPro) to minimize post-transcriptional gene silencing that can reduce yield. Optimize cultivation conditions through response surface methodology (RSM) to identify ideal combinations of temperature, light intensity, and nutrient composition . Implement careful harvest timing based on expression kinetics, typically coinciding with maximum photosynthetic activity for chloroplastic proteins. During purification, maintain reducing conditions through addition of appropriate reducing agents (DTT, β-mercaptoethanol) at concentrations that preserve the iron-sulfur cluster integrity without interfering with purification processes. For bacterial expression systems, consider fusion partners that enhance solubility (SUMO, thioredoxin, MBP) while implementing strategies to prevent formation of inclusion bodies. Through systematic application of these approaches, researchers can achieve up to 3-5 fold improvements in functional petC1 yield compared to non-optimized conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.