Recombinant Nicotiana tabacum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
petD
Target Protein Sequence
MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nta:800494

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6f complex and what role does the petD subunit play?

The cytochrome b6f complex is a crucial membrane protein complex in the electron transport chain of oxygenic photosynthesis. It mediates electron transfer between photosystem II and photosystem I while contributing to the formation of a proton gradient across the thylakoid membrane.

How is the petD gene organized in Nicotiana tabacum?

In Nicotiana tabacum, the petD gene is located in the chloroplast genome. The gene undergoes transcription and processing similar to other chloroplast genes involved in the cytochrome b6f complex. RNA gel blot analyses have shown that petD transcripts undergo normal processing in tobacco plants, with the mature transcript being translated to form the subunit IV protein .

The expression of petD is coordinated with other components of the cytochrome b6f complex (including petA for cytochrome f and petB for cytochrome b6) to ensure proper stoichiometry during complex assembly .

What transformation methods are effective for Nicotiana tabacum in petD studies?

Two primary methods have proven effective for stable plastid transformation in Nicotiana tabacum:

  • Biolistic method: Uses a particle gun to deliver DNA directly into chloroplasts

  • PEG-mediated transformation: Involves treatment of isolated protoplasts with polyethylene glycol in the presence of DNA

Research has demonstrated that both methods achieve comparable efficiency in tobacco, with PEG-mediated transformation yielding between 20 and 50 plastid transformants per experiment (106 viable treated protoplasts) . The PEG method offers cost advantages as it doesn't require expensive particle gun equipment, with the main considerations being protoplast handling and cultivation .

For selection of transformed plastids, the aadA gene (encoding spectinomycin and streptomycin resistance) is one of the most commonly used markers .

What experimental approaches can detect disruptions in cytochrome b6f assembly due to petD mutations?

Multiple complementary approaches can be employed to detect and characterize cytochrome b6f assembly defects resulting from petD mutations:

Spectroscopic Analysis:

  • 77K fluorescence emission spectroscopy can assess state transitions (ST) and antenna redistribution between PSI and PSII

  • Redox kinetics measurements can directly quantify b6f activity, including cytochrome-f reduction and b-heme oxidation/reduction dynamics

Electron Transfer Measurements:
Researchers should examine both high-potential and low-potential electron transfer chains. In studies of N-terminal PetD mutants, measurements revealed:

  • ~20-fold slowdown in b-heme oxidation

  • ~10-fold slowdown in cytochrome-f reduction, indicating Qi-site impairment affecting the Qo-site

Protein Turnover Analysis:
Immunoprecipitation of in vivo labeled proteins can determine synthesis and degradation rates. Research has demonstrated that certain mutations can lead to a 10-fold higher rate of protein turnover for subunit IV compared to wild-type plants .

How can researchers optimize recombinant expression of petD in Nicotiana tabacum?

Optimizing recombinant petD expression requires attention to several factors:

Selection of Nicotiana Host:
Among 52 Nicotiana varieties evaluated for recombinant protein production, Nicotiana tabacum (cv. I 64) demonstrated:

  • Highest transient concentrations of recombinant proteins

  • Large biomass production

  • Relatively low alkaloid content

This makes it potentially the most effective plant host for recombinant petD production.

Expression Systems:

  • Transient expression: Shows significant variation in recombinant protein accumulation across different Nicotiana hosts

  • Stable transgenic expression: Demonstrates more consistent protein concentration across varieties

Subcellular Targeting:
For improved stability and functionality of recombinant proteins in N. tabacum, endoplasmic reticulum (ER) targeting has proven effective. This approach includes:

  • Using strong ribosome binding sites (e.g., Omega leader sequence from Tobacco Mosaic Virus)

  • Incorporating ER-targeted N. tabacum pathogenesis-related protein 1 N-terminal sequences

  • Adding C-terminal KDEL retention signals

  • Including purification facilitator tags (e.g., six-histidine tag)

Alternative Culture Systems:
Hairy root cultures offer an alternative production system, with documented yields of other recombinant proteins reaching 63.81 μg/g of fresh weight .

What techniques can measure electron transfer kinetics in wild-type versus petD-mutant cytochrome b6f complexes?

Spectroscopic Techniques for Electron Transfer Analysis:

When examining N-terminal mutations in PetD, researchers observed:

  • Under aerobic conditions: ~20-fold slower b-heme oxidation and ~10-fold slower cytochrome-f reduction

  • Under anoxic conditions: ~25-fold slowdown in high-potential chain activity

These measurements directly correlate with diminished electron transfer rates (ETR) and enhanced P700 donor side limitation, confirming the critical role of the PetD N-terminus in complex function.

How do data inconsistencies impact quantitative analysis of recombinant petD expression?

Data inconsistencies can significantly impact quantitative analysis and reproducibility in petD research. A comprehensive audit of manual data registration revealed:

  • 41.8% of patient studies showed inconsistencies between patient records and DICOM entries

  • 98.0% differed from protocol targets

  • 50.7% were noncompliant with allowed variations in experimental parameters

These inconsistencies can lead to substantial errors in quantitative measurements, with error factors ranging from -98% to +45% in reported values .

Recommendations for Reducing Data Inconsistencies:

  • Implement parameter checks as part of standard data processing

  • Standardize protocols for data collection and processing

  • Assess intracenter quantification variability before attempting intercenter harmonization

  • Increase transparency in reporting methodological variances

  • Follow standardized reporting templates and checklists

Essential Controls for petD Mutation Studies:

  • Wild-type comparison: Include unmodified N. tabacum with identical genetic background

  • Multiple mutant lines: Generate and analyze multiple independent transgenic lines to confirm phenotype consistency

  • Complementation controls: Reintroduce wild-type petD to confirm phenotype rescue

  • Transcript analysis: Perform RNA gel blot analyses to verify that chloroplast genes for cytochrome f, cytochrome b6, and subunit IV are transcribed and properly processed

  • Protein synthesis verification: Use immunoprecipitation of in vivo labeled proteins to confirm protein synthesis and measure turnover rates

  • Analysis of interacting subunits: Examine the expression and stability of other cytochrome b6f complex components, as deficiencies in one subunit (such as the Rieske Fe-S protein) can affect the stability of other components

How can researchers formulate appropriate research questions when studying petD mutations?

Formulating precise research questions is crucial for productive petD research. Key principles include:

Question Scope Considerations:

  • Too broad: "How does petD affect photosynthesis?" (yields overwhelming results)

  • Too narrow: "What is the effect of alanine substitution at position 4 of petD on electron transfer in PSII in tobacco cultivar SNN at pH 7.2?" (likely too specific for sufficient literature)

  • Appropriate: "How does the N-terminal region of petD affect cytochrome b6f complex function in Nicotiana tabacum?"

PICOT Framework Application:

  • P (Population): Specify the exact tobacco variety/mutant

  • I (Intervention): Detail the mutation or manipulation being studied

  • C (Comparison): Define appropriate controls

  • O (Outcome): Specify measurable parameters

  • T (Time): Establish appropriate timeframe for measurements

This structured approach ensures questions are both answerable and scientifically valuable.

What metabolomic approaches can detect downstream effects of petD mutations?

Direct IR-LDI-oTOF mass spectrometry represents an effective approach for comprehensive metabolic profiling of tobacco plants with petD mutations. This technique:

  • Allows simultaneous profiling of numerous metabolites

  • Can be applied directly to fresh tissue

  • Provides high lateral resolution

  • Facilitates mapping of metabolic responses across leaf tissues

Data Analysis Strategy:
Principal component analysis (PCA) can effectively reduce complex LDI MS data to manageable datasets, identifying key metabolites that contribute to variance between wild-type and mutant plants. In similar plant defense studies, this approach identified:

  • Phaseic acid (m/z 281.140) related to ABA turnover

  • Tyramine (m/z 138.091) related to phenolic metabolism

  • HOO-γ-LA (m/z 311.220) and its methyl ester related to LOX activity and JA turnover

This approach would likely detect metabolic shifts resulting from altered electron transport in petD mutants.

What protocols ensure reproducibility in petD functional studies?

To ensure reproducibility in petD functional studies, researchers should:

  • Pre-register study protocols prior to data collection, specifying:

    • Sample sizes and power calculations

    • Inclusion/exclusion criteria

    • Statistical analysis methods

    • Primary and secondary outcome measures

  • Standardize experimental conditions:

    • Growth conditions (light intensity, photoperiod, temperature)

    • Plant age and developmental stage

    • Tissue collection and processing methods

  • Document data processing steps:

    • Raw data preservation

    • Analysis code sharing

    • Parameter documentation

    • Validation against benchmark datasets

  • Address data inconsistencies:

    • Report protocol deviations

    • Document measurement variability

    • Provide complete methodological details

    • Follow field-specific reporting guidelines

  • Implement containerized workflows:

    • Use reproducible computational environments

    • Share analysis pipelines

    • Document software versions and parameters

How can petD mutations inform our understanding of cytochrome b6f complex assembly?

Studies of petD mutations provide crucial insights into cytochrome b6f complex assembly:

Assembly Dependencies:
Research with a mutant Lemna perpusilla containing less than 1% of normal cytochrome b6f complex protein subunits revealed:

  • Chloroplast genes for cytochrome f, cytochrome b6, and subunit IV (petA, petB, and petD) are transcribed and processed normally

  • Cytochrome f and subunit IV proteins are synthesized

  • Subunit IV shows a 10-fold higher turnover rate in the absence of other complex components

  • The nuclear-encoded Rieske Fe-S protein (petC) appears to play a key role in complex assembly

These findings suggest a hierarchical assembly process where:

  • Individual subunits are synthesized independently

  • Assembly requires the presence of all core components

  • Unassembled subunits are rapidly degraded

  • Nuclear-encoded components may regulate the assembly process

What bioinformatic approaches can predict functional impacts of petD mutations?

Bioinformatic Prediction Framework for petD Mutations:

  • Sequence Conservation Analysis:

    • Multiple sequence alignment of petD across species

    • Identification of highly conserved residues/regions

    • Calculation of conservation scores to prioritize critical residues

  • Structural Modeling:

    • Generate homology models based on the cytochrome b6f complex structure

    • Analyze interactions between PetD and other subunits

    • Identify key interface residues and structural elements

  • Molecular Dynamics Simulations:

    • Simulate wild-type and mutant proteins in membrane environment

    • Assess stability, flexibility, and conformational changes

    • Predict effects on complex assembly and function

  • Machine Learning Approaches:

    • Train models using known mutation effects

    • Predict functional consequences of novel mutations

    • Integrate multiple data types (sequence, structure, dynamics)

Key insights from structural studies show that the cytochrome b6f complex forms a dimer with 26 trans-membrane helices, with the dimer interface enriched in aromatic residues . This information can guide mutation analysis focused on complex stability and assembly.

How does the research on Nicotiana tabacum petD translate to other plant species?

Research on N. tabacum petD has broader implications for understanding cytochrome b6f complex function across plant species:

Cross-Species Relevance:

  • The cytochrome b6f complex is highly conserved across photosynthetic organisms

  • Studies in tobacco provide a foundation for understanding similar processes in crops and model plants

  • Fundamental mechanisms of electron transport are conserved, though regulatory details may vary

Translational Considerations:

Complementary Model Systems:
Studies in Lemna perpusilla revealed similar principles of cytochrome b6f complex assembly dependence on the Rieske Fe-S protein , supporting the translational value of tobacco research to other plant systems.

What are the implications of petD N-terminal modifications for plant photosynthetic efficiency?

Functional Impact of N-terminal Modifications:
Studies show that modifications to the PetD N-terminus result in:

  • ~20-fold slowdown in b-heme oxidation

  • ~10-fold slowdown in cytochrome-f reduction

  • Significantly diminished electron transfer rates (ETR)

  • Enhanced P700 donor side limitation

These effects directly impact the plant's photosynthetic efficiency and can manifest as:

  • Reduced growth rates under light-limiting conditions

  • Altered state transitions affecting light harvesting balance

  • Compromised non-photochemical quenching (NPQ) capacity

  • Impaired cyclic electron flow around PSI

Potential Applications:
Understanding these mechanisms could lead to targeted modifications to optimize photosynthetic efficiency for specific environmental conditions or to enhance biomass production in bioenergy crops.

What are common challenges in recombinant petD expression and how can they be addressed?

Common Challenges and Solutions in Recombinant petD Expression:

ChallengePotential CausesSolution Strategies
Low expression levelsCodon usage bias, Improper promoter selection, RNA instabilityCodon optimization, Use strong promoters (e.g., TMV Omega leader), Add stabilizing elements
Protein instabilityRapid degradation, Improper foldingTarget to ER with KDEL retention signal, Co-express chaperones, Add stabilizing fusion tags
Improper complex assemblyMissing interaction partners, Stoichiometric imbalanceCo-express multiple subunits, Balance expression levels, Add assembly factors
Toxicity to host cellsMembrane disruption, Interference with native complexesUse inducible expression systems, Optimize growth conditions, Select appropriate host variety

Research has shown that targeting recombinant proteins to the endoplasmic reticulum using N. tabacum's pathogenesis-related protein 1 N-terminal and C-terminal KDEL sequences significantly improves stability and functionality .

How can researchers resolve contradictory results in petD function studies?

When faced with contradictory results in petD research, consider the following systematic approach:

  • Verify experimental conditions:

    • Growth conditions (light intensity, photoperiod, temperature)

    • Plant age and developmental stage

    • Sample collection and processing methods

  • Check genetic background:

    • Confirm genotype of plant material

    • Verify transgene integration and copy number

    • Assess potential somaclonal variation

  • Evaluate measurement techniques:

    • Compare methodological differences between studies

    • Assess calibration and standardization procedures

    • Consider sensitivity and specificity of techniques

  • Analyze data handling discrepancies:

    • Review statistical approaches

    • Check for data transformations

    • Assess outlier handling procedures

  • Design reconciliation experiments:

    • Replicate both contradictory protocols in parallel

    • Introduce controlled variables to identify critical factors

    • Consider blind analysis to reduce bias

Research has shown that data entry inconsistencies can cause sizeable errors in quantitative analyses, with error factors ranging from -98% to +45% in reported values , emphasizing the importance of methodological transparency and standardization.

What strategies can improve reproducibility in petD studies across different laboratories?

Improving cross-laboratory reproducibility in petD research requires systematic approaches:

  • Standardize protocols:

    • Develop and share detailed standard operating procedures

    • Create protocol repositories with version control

    • Establish minimum reporting requirements

  • Implement containerized workflows:

    • Use Docker or similar technologies for consistent computational environments

    • Create portable analysis pipelines

    • Document software versions and parameters

  • Establish data repositories:

    • Create centralized repositories for raw and processed data

    • Implement standardized data formats

    • Require data availability as a condition for publication

  • Conduct multi-laboratory validation:

    • Perform round-robin studies with identical samples

    • Quantify inter-laboratory variability

    • Identify and address sources of variation

  • Pre-register experimental plans:

    • Document hypotheses and analysis plans before data collection

    • Register expected outcomes and sample sizes

    • Limit post-hoc analyses without clear justification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.