Recombinant Nicotiana tabacum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Cytochrome b6f Complex

PetB (Cytochrome b6) is a core subunit of the cytochrome b6f complex, which bridges Photosystem II (PSII) and Photosystem I (PSI). It facilitates electron transfer from plastoquinol to plastocyanin and drives proton translocation across the thylakoid membrane .

Key Interactions

Partner SubunitFunction
PetA (Cytochrome f)Forms a heterodimer with PetB; contains a c-type heme for electron transfer
PetC (Rieske Fe-S Protein)Contains a [2Fe-2S] cluster for electron transfer to plastocyanin
PetD (Subunit IV)Anchors the complex in the membrane; stabilizes PetA and PetB
PetN (Ycf6)Essential for complex assembly/stability; identified via knockout studies

Regulatory Mechanisms

PetB expression is tightly regulated at the transcript and protein levels:

RNA Stability

  • PrfB3: A plastid-encoded protein that binds petB mRNA to stabilize it, particularly under stress conditions .

  • Phenotype of prfB3 mutants: Severe reduction in cytochrome b6f complex levels, leading to photosynthetic incompetence .

Genetic Context

  • Operon Organization: petB is co-transcribed with psbB, psbH, petD, and psbN in N. tabacum, ensuring coordinated expression of PSII and b6f complex genes .

Research Applications

Recombinant PetB is widely used in structural and functional studies:

ApplicationDetails
Antibody ProductionAnti-PetB antibodies (e.g., AS08 330) enable detection via Western blotting
ELISA KitsQuantification of PetB levels in plant extracts
Structural StudiesCrystallization of His-tagged PetB for X-ray crystallography

5.1. Stress-Dependent Regulation

  • PrfB3-mediated stabilization: petB transcripts are protected from degradation under environmental stress, ensuring sustained b6f complex activity .

  • Impact of ycf6 (petN) deletion: Complete loss of functional b6f complexes due to impaired assembly, highlighting PetN’s role in subunit coordination .

5.2. Genetic Interactions

  • Operon dynamics: The psbB-psbH-petB-petD operon ensures synchronized production of PSII and b6f complex subunits .

  • Nuclear-encoded regulators: Proteins like PrfB3 underscore the interplay between plastid and nuclear genomes in complex assembly .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: nta:800462

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 (petB) and what is its role in Nicotiana tabacum?

Cytochrome b6 (petB) is a core protein component of the cytochrome b6f complex, which plays a critical role in the photosynthetic electron transport chain of Nicotiana tabacum. The protein functions as an integral part of a multiprotein membrane-located complex composed of eight different subunits. Six of these subunits, including PetB (cytochrome b6), are encoded in the chloroplast genome, while two are encoded in the nucleus. The complex functions as a dimer, with the transmembrane domains of cytochrome b6 directly involved in monomer-monomer interaction and stability of the complex .

Methodologically, studies investigating the role of cytochrome b6 typically employ electron transport measurements, mutant analyses, and protein interaction studies. Researchers should consider using multiple complementary approaches to fully characterize its function, including both in vivo and in vitro experimental systems.

What is the amino acid sequence and structural characteristics of Nicotiana tabacum Cytochrome b6?

The full-length Nicotiana tabacum Cytochrome b6 (petB) protein consists of 215 amino acids with the following sequence:

MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRPTVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTLTRFYSLHTFVLPLLTAVFMLMHFLMIRKQGISGPL

The protein contains transmembrane domains that anchor it within the thylakoid membrane and enable its interaction with other components of the cytochrome b6f complex. These transmembrane regions are particularly important for the stability of the dimeric structure of the complex .

When studying the structural characteristics, researchers should employ methods such as crystallography, cryo-electron microscopy, or computational modeling approaches. These techniques can reveal crucial information about protein folding, interaction surfaces, and functional domains.

How does the expression of Cytochrome b6 differ between Nicotiana species?

Nicotiana tabacum is an allotetraploid species derived from progenitors of Nicotiana sylvestris and Nicotiana tomentosiformis . While the protein sequence of Cytochrome b6 is highly conserved across these species, there are notable differences in gene regulation and post-transcriptional modifications.

RNA editing, a post-transcriptional process that converts specific C to U in organelle mRNAs, shows variations between Nicotiana species. For example, in the related NDH complex, editing efficiency at the ndhD-1 site differs between species: N. tomentosiformis (15%), N. tabacum (42%), and N. sylvestris (37%) . Similar variations might exist for cytochrome b6-related transcripts.

To study these differences methodologically, researchers should consider:

  • Comparative transcriptomics across Nicotiana species

  • RNA editing site analysis using high-throughput sequencing

  • Protein accumulation studies using species-specific antibodies

  • Functional assays to determine if sequence or expression differences result in altered activity

What are the optimal conditions for expressing recombinant Nicotiana tabacum Cytochrome b6 in bacterial systems?

Recombinant Nicotiana tabacum Cytochrome b6 is commonly expressed in E. coli expression systems . For optimal expression, researchers should consider the following methodological approaches:

  • Expression construct design:

    • Use of the full-length sequence (1-215 amino acids)

    • Addition of an N-terminal His tag for purification

    • Codon optimization for E. coli expression

  • Expression conditions:

    • Induction parameters (IPTG concentration, temperature, and duration)

    • Media composition, including supplementation with heme precursors

    • Growth phase at induction (typically mid-log phase)

  • Cell lysis and membrane protein extraction:

    • Gentle detergent-based extraction methods

    • Sonication or pressure-based disruption systems

    • Inclusion of protease inhibitors to prevent degradation

Researchers should systematically optimize these parameters for their specific experimental setup, as membrane protein expression can be particularly challenging and may require strain-specific adaptations.

What purification strategies are most effective for recombinant Cytochrome b6?

Purification of recombinant Cytochrome b6 requires specialized approaches due to its membrane-associated nature. Based on current methodologies, an effective purification strategy includes:

  • Initial purification using affinity chromatography:

    • Nickel-NTA chromatography for His-tagged proteins

    • Careful selection of detergents to maintain protein folding and activity

    • Gradient elution to improve purity

  • Secondary purification steps:

    • Size exclusion chromatography to separate monomeric and dimeric forms

    • Ion exchange chromatography for removal of contaminating proteins

    • Specialized membrane protein purification systems

  • Quality control assessments:

    • SDS-PAGE analysis with expected molecular weight of approximately 24 kDa

    • Western blotting with anti-His or cytochrome b6-specific antibodies

    • Activity assays to confirm functional integrity

For optimal results, the purified protein should be maintained in a stabilizing buffer, typically Tris-based with 6% trehalose at pH 8.0 . Aliquots can be prepared with 50% glycerol for long-term storage at -80°C .

How should recombinant Cytochrome b6 be stored and handled to maintain activity?

Proper storage and handling of recombinant Cytochrome b6 is critical for maintaining its structural integrity and biological activity. Research-based recommendations include:

  • Storage conditions:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • For reconstituted protein, store at -20°C for extended storage

    • Working aliquots can be maintained at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge vials before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 50% for long-term storage

  • Handling considerations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce activity

    • Use appropriate buffer systems (Tris-based buffer, pH 8.0)

    • Consider inclusion of reducing agents if disulfide formation is a concern

These protocols ensure maximum retention of protein functionality for downstream applications in research settings.

How can researchers investigate the role of Cytochrome b6 in the electron transport chain?

Investigating the role of Cytochrome b6 in the electron transport chain requires sophisticated experimental approaches. Methodologically, researchers can employ:

  • In vitro electron transport assays:

    • Isolated thylakoid membrane preparations

    • Purified reconstituted protein complexes

    • Spectroscopic measurements of electron transfer kinetics

  • PAM fluorometry techniques:

    • Monitor NDH complex activity through transient increases in chlorophyll fluorescence after turning off actinic light

    • Compare wild-type and mutant responses to identify specific contributions of cytochrome b6

    • Track electron flow through photosynthetic complexes

  • Genetic manipulation approaches:

    • CRISPR/Cas9 editing to create specific mutations in the petB gene

    • Analysis of knockout or knockdown lines

    • Complementation studies with modified versions of the protein

  • Structural studies to correlate function:

    • Identification of key amino acid residues involved in electron transfer

    • Mutagenesis of specific residues to alter electron transport properties

    • Correlation of structural features with functional outcomes

What techniques can be used to study interactions between Cytochrome b6 and other components of the b6f complex?

Studying protein-protein interactions within the cytochrome b6f complex requires specialized techniques that can capture these membrane-bound associations. Effective methodological approaches include:

  • Co-immunoprecipitation and pull-down assays:

    • Use of tagged recombinant proteins to isolate interacting partners

    • Crosslinking approaches to stabilize transient interactions

    • Mass spectrometry analysis of isolated complexes

  • Förster Resonance Energy Transfer (FRET) analyses:

    • Fluorescently labeled protein components to detect proximity

    • Live-cell imaging to track interactions in native environments

    • Quantitative analysis of energy transfer efficiency

  • Blue Native PAGE and complexome profiling:

    • Separation of intact protein complexes under native conditions

    • Identification of subcomplexes and assembly intermediates

    • Tracking complex formation and stability

  • Structural biology approaches:

    • Cryo-electron microscopy of intact complexes

    • X-ray crystallography of co-purified components

    • Computational modeling of interaction interfaces

These techniques can reveal how cytochrome b6 participates in monomer-monomer interactions and contributes to the stability of the dimeric b6f complex . Understanding these interactions is crucial for elucidating the assembly and function of this essential photosynthetic complex.

How can recombinant Cytochrome b6 be used to study the effects of environmental stressors on photosynthetic efficiency?

Recombinant Cytochrome b6 provides a valuable tool for investigating how environmental stressors affect photosynthetic efficiency. Methodological approaches include:

  • In vitro stress simulation studies:

    • Exposure of purified protein to varying temperature, pH, or salt conditions

    • Measurement of structural stability and activity under stress

    • Identification of particularly vulnerable regions of the protein

  • Comparative analysis with stress-induced modifications:

    • Post-translational modification profiling under stress conditions

    • Site-directed mutagenesis to mimic stress-induced changes

    • Functional characterization of modified proteins

  • Reconstitution experiments:

    • Integration of recombinant protein into membrane systems

    • Measurement of electron transport before and after stress treatments

    • Correlation of structural changes with functional outcomes

  • Development of biosensor applications:

    • Engineering of recombinant cytochrome b6 as a stress sensor

    • Spectroscopic detection of stress-induced conformational changes

    • High-throughput screening of protective compounds

These approaches can provide insights into how environmental factors impact the function of this critical component of the photosynthetic apparatus, potentially leading to strategies for enhancing stress resilience in crop plants.

What are common challenges in expressing and purifying functional Cytochrome b6, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Cytochrome b6. Methodological solutions include:

ChallengeCauseSolution
Low expression yieldsMembrane protein toxicity to host cellsUse specialized E. coli strains (C41, C43); lower induction temperature; regulate expression levels
Inclusion body formationImproper foldingCo-express with chaperones; use solubilization tags; optimize induction conditions
Loss of heme incorporationInsufficient cofactor availabilitySupplement growth media with δ-aminolevulinic acid; use E. coli strains optimized for heme incorporation
Aggregation during purificationDetergent issuesTest multiple detergent types and concentrations; include stabilizing agents like glycerol or trehalose
Proteolytic degradationSensitivity to proteasesInclude protease inhibitor cocktails; reduce purification time; maintain low temperature
Low activity of purified proteinDenaturation during purificationAvoid harsh elution conditions; verify spectral properties; confirm heme incorporation

Addressing these challenges requires systematic optimization and often a combination of approaches tailored to the specific expression system and downstream applications.

How can researchers verify the functional integrity of purified recombinant Cytochrome b6?

Verifying the functional integrity of purified recombinant Cytochrome b6 is essential for ensuring reliable experimental results. Methodological approaches include:

  • Spectroscopic analysis:

    • UV-visible absorption spectroscopy to confirm characteristic heme spectra

    • Reduced minus oxidized difference spectra to verify redox activity

    • Circular dichroism to assess secondary structure integrity

  • Functional assays:

    • Electron transfer activity measurements with artificial electron donors/acceptors

    • Reconstitution with other components of the b6f complex to assess complex formation

    • Lipid bilayer incorporation studies to verify membrane insertion

  • Structural verification:

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine stability

    • Native PAGE analysis to confirm oligomeric state

  • Comparative analysis:

    • Parallel testing against native protein isolated from thylakoid membranes

    • Comparison with published biochemical and biophysical parameters

    • Activity benchmarking against established standards

These complementary approaches provide a comprehensive assessment of protein quality and suitability for downstream research applications.

What considerations are important when designing experiments to compare wild-type and mutant forms of Cytochrome b6?

When comparing wild-type and mutant forms of Cytochrome b6, several methodological considerations are critical for obtaining valid and reproducible results:

  • Expression system consistency:

    • Use identical expression vectors and host strains

    • Maintain consistent induction and growth conditions

    • Process samples in parallel to minimize batch effects

  • Purification standardization:

    • Apply identical purification protocols to all variants

    • Verify comparable purity levels using multiple methods

    • Normalize protein concentrations accurately

  • Structural integrity verification:

    • Confirm proper folding of all variants before functional comparisons

    • Assess heme incorporation quantitatively

    • Verify membrane integration properties

  • Experimental design considerations:

    • Include appropriate controls for each experiment

    • Perform sufficient biological and technical replicates

    • Use statistical methods appropriate for the data type

  • Integration of multiple analytical approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Correlate structural changes with functional outcomes

    • Consider both isolated protein and complex-integrated behaviors

These methodological considerations ensure that observed differences between wild-type and mutant proteins can be confidently attributed to the specific mutations rather than experimental artifacts.

How might genetic engineering of Cytochrome b6 contribute to improving photosynthetic efficiency?

Genetic engineering of Cytochrome b6 represents a promising approach for enhancing photosynthetic efficiency. Methodological considerations for this research direction include:

  • Targeted modification strategies:

    • Site-directed mutagenesis of rate-limiting amino acid residues

    • Optimization of electron transfer kinetics through protein engineering

    • Enhancement of protein stability under variable environmental conditions

  • Complex stoichiometry manipulation:

    • Overexpression studies to increase complex abundance

    • Investigation of whether cytochrome b6f complex is a limiting factor in electron transport

    • Coordination with other components to maintain proper stoichiometry

  • Research has indicated that the cytochrome b6f complex represents a potential limiting step in the electron transport chain, suggesting that increasing its activity could potentially enhance photosynthesis rates . This approach requires careful consideration of:

    • The multiprotein nature of the complex

    • The proper assembly of all eight subunits

    • The coordination of chloroplast and nuclear gene expression

  • Cross-species comparative approaches:

    • Identification of naturally occurring variations with enhanced properties

    • Mining biodiversity for optimal cytochrome b6 variants

    • Creation of chimeric proteins incorporating beneficial features

These approaches may contribute to developing crops with improved photosynthetic efficiency, potentially increasing yield and resilience under changing environmental conditions.

What are the implications of RNA editing differences in Nicotiana species for Cytochrome b6 research?

RNA editing variations between Nicotiana species have important implications for cytochrome b6 research and provide interesting research opportunities. Methodological considerations include:

  • Comparative analysis of editing patterns:

    • Systematic identification of RNA editing sites in cytochrome b6 transcripts across species

    • Quantification of editing efficiency at each site

    • Correlation of editing patterns with protein function

  • Trans-factor identification and characterization:

    • Identification of species-specific editing factors

    • Analysis of CRR4 orthologs and other potential trans-factors

    • Investigation of evolutionary patterns in editing machinery

  • Functional consequences assessment:

    • Determination of how editing affects protein structure and function

    • Investigation of whether editing efficiency correlates with complex activity

    • Analysis of editing under different environmental conditions

  • Evolutionary implications:

    • Study of editing site conservation across related species

    • Investigation of selection pressures on editing mechanisms

    • Development of models for the evolution of RNA editing in plastids

Understanding these RNA editing differences can provide insights into the evolution of post-transcriptional regulatory mechanisms and their impact on protein function across Nicotiana species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.