Recombinant Nicotiana tabacum Ethylene receptor (ETR1)

Shipped with Ice Packs
In Stock

Description

Key Functions and Characteristics

  • Ethylene Perception: NtETR1 is a receptor that perceives ethylene, a gaseous plant hormone that regulates various physiological processes, including fruit ripening, senescence, and stress responses .

  • Regulation of Plant Growth: By interacting with other proteins, NtETR1 influences plant growth and development. For example, it interacts with translationally controlled tumor protein (NtTCTP), impacting seedling growth .

  • Subcellular Localization: NtETR1 is found in the endoplasmic reticulum (ER), a cellular organelle involved in protein synthesis and transport .

Interactions with Other Proteins

NtETR1 interacts with several other proteins that modulate its function and downstream signaling.

  • RTE1 (Reversion-to-Ethylene Sensitivity): RTE1 is a membrane protein that promotes the signaling state of ETR1 . The interaction between RTE1 and ETR1 has a high affinity, which is important in the regulation of ETR1 .

  • NtTCTP (Tobacco Translationally Controlled Tumor Protein): NtTCTP interacts with certain ethylene receptors but does not interact with NtETR1 . Genetic analysis showed that NtTCTP is required for the function of NTHK1 .

Research Findings

Research has provided valuable insights into the function and interactions of NtETR1.

  • In vivo and In vitro Methods: The physical association of RTE1 and ETR1 has been demonstrated using in vivo and in vitro methods .

  • Co-immunoprecipitation Assays: Interactions between proteins like NTHK1 and NtTCTP have been confirmed through co-immunoprecipitation assays .

  • Expression Patterns: Studies on NtTCTP transcript levels in different plant organs/tissues by quantitative real-time (qRT)-PCR reveal that transcripts of NtTCTP were more abundant in root than in other organs of wild-type tobacco plants .

Genetic and Molecular Studies

Genetic and molecular studies have further elucidated the role of NtETR1.

  • Mutational Analysis: Specific mutations in ethylene receptors like ETR1 can distinguish them from other receptors, as revealed by genetic interaction with RTE1 .

  • Overexpression and Silencing: Overexpression and silencing of interacting proteins like NtTCTP affect ethylene response and plant growth, providing insights into their functional roles .

Role in Stress Response

Ethylene and its receptors, including NtETR1, are involved in plant responses to stress.

  • ROS Scavenging: Ethylene receptor ETR1 is a critical node in mediating the cross-talk between ethylene and ROS signaling in stomatal guard cells .

  • Ethylene Response Factors (ERFs): ERFs are important ethylene-signaling regulators functioning in plant defense responses against biotic and abiotic stresses .

Data Tables

The following tables summarize key interactions and expression patterns related to NtETR1.

Table 1: Protein Interactions of NtETR1

ProteinInteractionEffect
RTE1Physical associationPromotes ETR1 signaling state
NtTCTPNo direct interactionInteracts with NTHK1 and NTHK2, but not with NtETR1

Table 2: Expression Patterns of NtTCTP in Nicotiana tabacum

Organ/TissueTranscript Level
RootHigh
LeafModerate

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ETR1; Ethylene receptor; NT-ETR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-738
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
ETR1
Target Protein Sequence
MDCNCFDPQWPADELLMKYQYISDFFIAVAYFSIPIELVYFVQKSAVFPYRWVLVQFGAF IVLCGATHLINLWTSTAHTRTLAIVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELF LKNKAAELDREMGLIRTQEETGRYVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECAL WMPTPPGLELQLSYTLRHQNPIGFTVPIQLPVINQVFGTNRAVKISPNSPVARLRPAGKY MPGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSGSARQWHVHELELVEVVADQ VAVALSHAAILEESMRARDLLMEQNVALDLARREAEMAVRARNDFLAVMNHEMRTPMHAI IALSSLLQETELTPEQRLMVETILKSSNLLATLINDVLDLSRLEDGSLQLDVGTFNLHVL FRKVLNLIKPIASVKNCLSRLTCLQICPEFAIGDEKRLMQILLNVVGNAVKFSKEGSVSI SAVAAKSESLSDPRAPEFFPVQSENHFYLRVQVKDTGSGINPQDIPKLFCKFAQNQALAT KSSGGTGLGLAISKRFVNLMEGHIWIESEGLGKGSTAIFIVKLGIPGRSNEPKLPFMPRL PANHMQMTFQGLKVLIMDDNGFSRMVTKGLLVHLGCDVTTVSSGDECLRVLTQEHKVVFM DVSIPGIDCYEVAVQIHEKFGKHHNRPLIVALTGNTDRVTKENCMRVGMDGVILKPVSVD KMRSVLSELLEHGVILQS
Uniprot No.

Target Background

Function
May function early in the ethylene signal transduction pathway, potentially as an ethylene receptor or a pathway regulator.
Database Links

UniGene: Nta.3590

Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the classification and structure of tobacco ETR1?

NtETR1 belongs to subfamily I of plant ethylene receptors, which differs structurally and functionally from subfamily II receptors like NTHK1 and NTHK2 in tobacco. The receptor contains three transmembrane domains at the N-terminus that form the ethylene-binding site, followed by a GAF domain, a histidine kinase domain, and a receiver domain at the C-terminus. Unlike subfamily II receptors, subfamily I receptors like NtETR1 maintain histidine kinase activity and exhibit different protein-protein interaction profiles . The receptor is predominantly localized to the endoplasmic reticulum membrane, which is a critical site for ethylene perception in plants.

How does NtETR1 differ from other ethylene receptors in tobacco?

NtETR1 differs significantly from subfamily II receptors (NTHK1 and NTHK2) in tobacco in terms of protein interactions and signaling mechanisms. For instance, while the translationally controlled tumor protein (NtTCTP) interacts with subfamily II receptors NTHK1 and NTHK2, it does not interact with the subfamily I receptor NtETR1 . This selective interaction was confirmed through yeast two-hybrid assays, where transformants harboring pSos-NtETR1 plus pMyr-NtTCTP could not grow on selective medium, unlike those containing subfamily II receptors . These differential interaction patterns suggest distinct roles in ethylene signaling pathways and plant development.

What is the expression pattern of ETR1 in different tobacco tissues?

ETR1 expression varies across different tissues in tobacco plants. While specific ETR1 expression data wasn't directly presented in the search results, related research on ethylene signaling components shows tissue-specific patterns. For example, NtTCTP (which interacts with other ethylene receptors but not ETR1) shows higher transcript abundance in roots than in other organs of wild-type tobacco plants . This differential expression pattern of ethylene signaling components suggests that ETR1 likely also exhibits tissue-specific expression patterns that correspond to the varying roles of ethylene in different plant tissues. Expression studies typically involve quantitative real-time PCR analysis of transcript levels in different plant organs including roots, stems, leaves, and reproductive structures.

How do protein-protein interactions modulate NtETR1 stability and function?

While NtETR1 does not interact with NtTCTP (unlike subfamily II receptors), it likely engages in other protein-protein interactions that regulate its stability and function. Research on related systems suggests that ethylene receptors form higher-order complexes that influence receptor stability and signaling. For subfamily II receptors, the association with NtTCTP prevents them from proteasome-mediated protein degradation . Analogous mechanisms for NtETR1 stability regulation might involve different interacting partners.

To investigate NtETR1 protein interactions, researchers typically employ multiple complementary techniques:

  • Yeast two-hybrid screening to identify potential interactors

  • In vitro pull-down assays with recombinant proteins

  • Co-immunoprecipitation from plant tissues expressing tagged ETR1

  • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

Understanding these interactions is critical for elucidating how ETR1 function is regulated at the molecular level.

What is the role of NtETR1 in tobacco response to biotic stress?

NtETR1 likely plays important roles in tobacco's response to pathogen attack, similar to ethylene receptors in other plant species. Related research shows that EDR1 (Enhanced Disease Resistance 1), which encodes a Raf-like mitogen-activated protein kinase, acts as a negative regulator of disease resistance and ethylene-induced senescence . Mutations in EDR1 enhance resistance to powdery mildew in both monocot and dicot plants .

The relationship between ETR1 and disease resistance pathways can be studied through:

  • Analysis of NtETR1 expression changes upon pathogen infection

  • Characterization of disease phenotypes in transgenic plants with altered NtETR1 levels

  • Investigation of downstream signaling events following ETR1 activation during pathogen challenge

These approaches help elucidate how ethylene perception through ETR1 contributes to the complex network of defense responses in tobacco.

How does phosphorylation affect NtETR1 signaling capacity?

The signaling capacity of NtETR1 is likely regulated by its phosphorylation status. As a subfamily I receptor with histidine kinase activity, NtETR1 undergoes autophosphorylation and phosphotransfer reactions as part of its signaling mechanism. Research methodologies to study ETR1 phosphorylation include:

  • In vitro kinase assays with purified recombinant ETR1 protein

  • Mass spectrometry analysis to identify specific phosphorylation sites

  • Phosphomimetic and phospho-null mutations to assess the functional significance of specific phosphorylation events

  • Phospho-specific antibodies to monitor phosphorylation status in vivo

These approaches help determine how phosphorylation events regulate ETR1 activity and its interactions with downstream signaling components in the ethylene response pathway.

What are the optimal conditions for expressing recombinant NtETR1 in heterologous systems?

Expressing functional recombinant NtETR1 presents several challenges due to its membrane-associated nature and multiple domains. Successful expression typically requires:

  • Expression system selection:

    • E. coli systems for partial domains (especially soluble C-terminal portions)

    • Yeast (P. pastoris or S. cerevisiae) for full-length protein

    • Insect cell systems (Sf9, Sf21) for improved membrane protein folding

  • Optimization parameters:

    • Temperature: Lower temperatures (16-20°C) often improve folding

    • Induction conditions: Low inducer concentrations with extended expression times

    • Culture medium: Rich media supplemented with specific additives for membrane proteins

    • Fusion tags: N-terminal MBP, GST, or His6 tags to improve solubility

  • Purification considerations:

    • Detergent screening to identify optimal solubilization conditions

    • Multi-step purification incorporating affinity, ion exchange, and size exclusion chromatography

    • Buffer optimization to maintain stability of the purified receptor

These optimizations are essential for obtaining functional recombinant ETR1 suitable for biochemical and structural studies.

What methods can be used to study ethylene binding to recombinant NtETR1?

Analyzing ethylene binding to recombinant NtETR1 requires specialized techniques due to the gaseous nature of the ligand. Effective methodologies include:

  • Radioligand binding assays:

    • Using radiolabeled ethylene (14C-ethylene or 3H-ethylene)

    • Membrane preparations containing recombinant ETR1

    • Saturation binding and competition assays to determine binding affinity (Kd)

  • Copper cofactor analysis:

    • ETR1 requires a copper cofactor for ethylene binding

    • ICP-MS or atomic absorption spectroscopy to quantify copper incorporation

    • Site-directed mutagenesis of copper-coordinating residues to assess binding requirements

  • Functional response measurements:

    • Ethylene-induced conformational changes measured by intrinsic tryptophan fluorescence

    • Changes in histidine kinase activity following ethylene binding

    • FRET-based sensors to detect conformational changes in real-time

These approaches provide complementary information about the biochemical mechanism of ethylene perception by NtETR1.

How can transgenic tobacco lines with modified ETR1 expression be generated and characterized?

Creating and characterizing transgenic tobacco lines with altered ETR1 expression involves several key steps:

These comprehensive analyses help elucidate ETR1 function in planta by correlating molecular alterations with physiological outcomes.

How do interactions between ethylene receptors and other hormone pathways regulate plant development?

Ethylene signaling through ETR1 and other receptors integrates with multiple hormone pathways to coordinate plant development. Research approaches to study these hormone interactions include:

  • Transcriptomic analysis:

    • RNA-seq to profile global gene expression changes in ETR1-modified plants

    • Identification of genes co-regulated by ethylene and other hormones

  • Genetic interaction studies:

    • Creation of double mutants combining ethylene receptor modifications with mutations in other hormone pathways

    • Analysis of phenotypic outcomes to determine epistatic relationships

  • Biochemical interaction identification:

    • Co-immunoprecipitation to identify physical interactions with components of other hormone pathways

    • Protein phosphorylation analyses to detect cross-pathway signaling events

Understanding these interaction networks helps explain how ethylene perception through ETR1 contributes to complex developmental processes in tobacco plants.

What are the differences in ethylene receptor function between model plants and crop species?

Comparative analysis of ethylene receptors across plant species reveals both conserved and divergent aspects of their function. While the core ethylene perception mechanism is conserved, species-specific adaptations exist:

  • Comparative genomic approaches:

    • Phylogenetic analysis of ethylene receptor sequences across species

    • Identification of conserved domains and variable regions

    • Analysis of selection pressures on different receptor components

  • Functional complementation studies:

    • Expression of tobacco ETR1 in Arabidopsis or rice receptor mutants

    • Assessment of the ability to rescue mutant phenotypes

    • Identification of species-specific functional requirements

  • Structural biology approaches:

    • Homology modeling based on available receptor structures

    • Identification of species-specific structural features

    • Structure-function relationship analysis

These comparative studies provide insights into how ethylene receptor function has evolved in different plant lineages and inform translational approaches for crop improvement.

What emerging technologies will advance our understanding of ETR1 function?

Several cutting-edge technologies are poised to revolutionize our understanding of ETR1 structure and function:

  • Cryo-electron microscopy for membrane protein complexes:

    • Determination of high-resolution structures of full-length ETR1

    • Visualization of conformational changes upon ethylene binding

    • Structural analysis of receptor-protein complexes

  • Advanced genetic editing with CRISPR/Cas systems:

    • Precise modification of specific ETR1 domains or residues

    • Creation of reporter fusions at endogenous loci

    • Multiplexed editing of multiple ethylene receptor family members

  • Single-cell transcriptomics and proteomics:

    • Cell-type specific analysis of ETR1 expression and function

    • Identification of cell-specific regulatory networks

    • Spatial mapping of ethylene responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.