Recombinant Nicotiana tabacum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

The ndhG subunit is part of the plastid-encoded NAD(P)H dehydrogenase (Ndh) complex, which shares homology with mitochondrial Complex I . Key functions include:

  • Electron Transport: Mediates electron donation from stromal NAD(P)H to plastoquinone (PQ), critical for maintaining redox balance under stress (e.g., CO₂ limitation) .

  • Chlororespiration: Supports dark reduction of the PQ pool, as evidenced by impaired fluorescence kinetics in ndhB-inactivated tobacco mutants .

  • Cyclic Photophosphorylation: Facilitates ATP synthesis under conditions limiting linear electron flow .

Mechanistic Insights:

  • Inactivation of ndhB (a related subunit) abolishes Ndh complex assembly, disrupting PQ reduction and causing growth retardation under stress .

  • The Ndh complex operates via a two-electron transfer mechanism, reducing quinones without generating reactive oxygen species .

Research Applications

Experimental Use Cases:

  • Enzyme Activity Assays: Used to measure NADH:plastoquinone oxidoreductase activity, with specific activity values up to 1.45 µmol/min/mg protein after purification .

  • Structural Studies: Aids in resolving the Ndh complex’s architecture, which has a total mass of ~550 kDa and includes 16 subunits .

  • Stress Response Models: Employed to study photosynthetic efficiency under low CO₂ or high light conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please specify them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFISNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. This process couples the redox reaction to proton translocation, thus conserving the redox energy in a proton gradient.
Database Links

KEGG: nta:800451

Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ndhG in the chloroplast electron transport chain?

NdhG is a subunit of the NAD(P)H-quinone oxidoreductase complex (NDH complex) in chloroplasts, which functions similarly to the mitochondrial complex I. This protein primarily participates in cyclic electron flow around photosystem I (PSI). The NDH complex mediates electron transfer from NAD(P)H to plastoquinone, contributing to ATP synthesis without producing NADPH, which is particularly important under stress conditions. Analysis of related ndh genes, such as ndhB, has demonstrated that disruption impairs cyclic electron flow around PSI, although plants can still grow normally under mild environmental conditions .

How does ndhG relate to other subunits in the NDH complex?

NdhG is one of the 11 chloroplast-encoded ndh genes (ndhA-K) that encode homologs of mitochondrial complex I subunits. Together, these subunits form the NDH complex integrated in the thylakoid membrane. The complex catalyzes the reduction of quinones through a two-electron transfer mechanism, preventing the formation of semiquinones and oxygen radicals. While each subunit has specific structural roles, they work cooperatively to facilitate electron transfer. The functional complex is stereospecific, with tobacco NAD(P)H-QR being B-stereospecific, distinguishing it from animal DT-diaphorase despite some functional similarities .

What methodologies are used to express recombinant ndhG in tobacco?

Recombinant ndhG can be expressed in tobacco using Agrobacterium tumefaciens-mediated transformation. This process involves:

  • Construction of an expression vector containing the ndhG gene with appropriate promoters and terminators

  • Transformation of tobacco leaf discs using A. tumefaciens

  • Selection of transformed plants on media containing appropriate antibiotics

  • Regeneration of transgenic plants through tissue culture

  • Confirmation of transformation through PCR or Southern blotting

  • Analysis of protein expression using techniques like ELISA, SDS-PAGE, and Western blotting

Tobacco has numerous advantages for recombinant protein production, including rapid growth, large biomass yield, and well-established transformation protocols .

How can I optimize the heterologous expression of ndhG in different Nicotiana varieties?

Optimization of recombinant ndhG expression requires consideration of multiple factors:

Tobacco variety selection: Among 52 Nicotiana varieties evaluated for recombinant protein production, Nicotiana tabacum (cv. I 64) demonstrated the highest transient expression levels while maintaining high biomass production and low alkaloid content. This makes it particularly suitable for recombinant protein expression .

Expression systems:

  • Transient expression: Provides rapid results but shows significant variation among Nicotiana varieties

  • Stable transgenic expression: Shows more consistent protein levels across different varieties but requires longer development time

Optimization parameters:

ParameterConsiderationsImpact on ndhG Expression
Promoter choiceConstitutive vs. inducibleAffects expression level and timing
Subcellular targetingChloroplast vs. cytosolic targetingInfluences protein folding and function
Codon optimizationMatch to tobacco codon usageCan significantly increase yield
Growth conditionsLight intensity, temperature, nutrientsAffects biomass and protein accumulation

For maximum yield, combining optimized genetic elements with ideal growth conditions for Nicotiana tabacum (cv. I 64) would likely produce the most robust expression of functional ndhG .

What are the challenges in purifying recombinant ndhG protein from tobacco chloroplasts?

Purification of chloroplastic ndhG presents several unique challenges:

  • Membrane association: As a component of the thylakoid membrane-bound NDH complex, ndhG is hydrophobic and requires detergent-based extraction methods.

  • Complex disassembly: The protein naturally exists as part of a multi-subunit complex, making it difficult to isolate in its native form. NAD(P)H-QR exists as a homotetramer of 94-100 kD with pairs of subunits linked by disulfide bridges .

  • Low abundance: Chloroplast proteins like ndhG often represent a small fraction of total leaf protein.

  • Co-purification of contaminants: Chlorophyll, phenolic compounds, and other plant metabolites can interfere with purification.

Methodological approach:

  • Use differential centrifugation to isolate intact chloroplasts

  • Employ detergent solubilization with optimized detergent:protein ratios

  • Implement affinity chromatography using tagged recombinant constructs

  • Apply size exclusion chromatography to separate the protein from contaminants

  • Confirm purity using SDS-PAGE, western blotting, and surface plasmon resonance

How does the disruption of ndhG compare with disruption of other ndh genes in tobacco?

Comparative analysis of ndh gene disruptions reveals functional differences:

When comparing ndhG disruption with other ndh genes:

GenePrimary Effect of DisruptionPlant PhenotypePhotosynthetic Impact
ndhBImpaired cyclic electron flowNormal growth under mild conditionsAltered chlorophyll fluorescence kinetics
ndhGSimilar to ndhB but may have unique features due to its specific role in the complexExpected to be similar to ndhBLikely altered electron transport
ndhA-KVariable effects depending on the specific subunitGenerally mild phenotypes under normal conditionsVarious degrees of impaired cyclic electron flow

Methodologically, gene disruption can be achieved through chloroplast transformation using particle bombardment with a vector carrying the target gene disrupted by an antibiotic resistance marker (e.g., aadA gene). Southern blot analysis and PCR amplification can confirm successful transformation and homoplasmy .

What controls should be included when studying ndhG function through genetic manipulation?

Robust experimental design for ndhG studies should include:

Essential controls:

  • Wild-type tobacco: Provides baseline for all physiological and molecular comparisons

  • Empty vector transformants: Controls for transformation effects unrelated to ndhG manipulation

  • Disruption of different ndh genes: Helps distinguish general NDH complex effects from ndhG-specific functions

  • Complementation lines: Reintroduction of functional ndhG to confirm phenotype specificity

Environmental conditions:
Since ndh gene functions may be dispensable under optimal conditions but critical under stress, experiments should include both standard greenhouse conditions and controlled stress treatments (high light, drought, temperature fluctuations) .

Analytical approaches:

  • Chlorophyll fluorescence measurements to assess photosystem function

  • P700 redox kinetics to evaluate cyclic electron flow

  • Growth and biomass measurements under various conditions

  • Proteomic analysis of thylakoid complexes to assess NDH complex assembly

This comprehensive approach enables researchers to distinguish between direct effects of ndhG disruption and secondary consequences on plant physiology .

How can I evaluate whether recombinant ndhG is properly integrated into the NDH complex?

Assessment of proper integration requires multiple analytical techniques:

  • Blue native PAGE: Separates intact protein complexes to verify the presence and molecular weight of assembled NDH complex

  • Co-immunoprecipitation: Using antibodies against other NDH subunits to confirm ndhG association

  • Functional assays:

    • Measure NAD(P)H dehydrogenase activity using artificial electron acceptors like ferricyanide or dichlorophenolindophenol

    • Monitor quinone reduction to hydroquinone through spectrophotometric methods

    • Analyze the B-stereospecificity of the enzymatic activity

  • Chloroplast isolation and fractionation: Confirm localization to thylakoid membranes

  • Electron microscopy: Visualize complex formation and membrane integration

Data interpretation should consider that the native enzyme functions as a homotetramer of 94-100 kD with an isoelectric point of 5.1, contains noncovalently bound flavin mononucleotide, and shows specific enzymatic characteristics including B-stereospecificity and high catalytic capability with both NADH and NADPH as electron donors .

How should contradictory results in ndhG functional studies be reconciled?

Contradictory results in ndhG research may arise from several factors:

  • Genetic background differences: Different tobacco cultivars may show variable phenotypes after ndhG manipulation

  • Environmental conditions: NDH complex function may be more critical under specific stresses

  • Technical considerations:

    • Incomplete gene knockout or variable expression of recombinant proteins

    • Differences in measurement techniques or conditions

    • Variations in protein extraction or purification methods

Reconciliation approach:

  • Perform meta-analysis of multiple studies

  • Standardize experimental conditions and methodologies

  • Use multiple analytical techniques to verify findings

  • Consider evolutionary conservation by comparing with homologous systems in different species

  • Examine possible redundancy in electron transport pathways

When evaluating enzyme kinetics data, consider that tobacco NAD(P)H-QR exhibits Kcat:Km ratios (with duroquinone) of 6.2 × 10⁷ and 8.0 × 10⁷ m⁻¹ s⁻¹ for NADH and NADPH respectively, indicating similar efficiency with both electron donors .

What bioinformatic approaches can identify potential post-translational modifications of ndhG?

Post-translational modifications (PTMs) of ndhG can be predicted and verified through:

Computational prediction:

  • Sequence-based PTM prediction algorithms for phosphorylation, acetylation, and other common modifications

  • Structural modeling to identify exposed residues susceptible to modification

  • Comparative analysis with known PTMs in homologous proteins from model organisms

Experimental validation approaches:

  • Mass spectrometry analysis of purified ndhG protein

  • Phosphoproteomic analysis of isolated chloroplasts

  • Site-directed mutagenesis of predicted modification sites

  • Antibodies against specific modifications

This multi-layered approach can help identify modifications that might regulate ndhG function or NDH complex assembly. Such modifications may be particularly relevant under stress conditions when cyclic electron flow becomes more important for plant survival .

How might CRISPR/Cas9 technology improve the study of ndhG compared to traditional transformation methods?

CRISPR/Cas9 offers several advantages for ndhG research compared to traditional chloroplast transformation:

Technical improvements:

  • Higher precision in gene editing with fewer off-target effects

  • Ability to create specific mutations rather than complete gene disruption

  • Potential for multiplexed editing of multiple ndh genes simultaneously

  • Faster development of transformed lines

Novel research applications:

  • Creation of site-specific mutations to study structure-function relationships

  • Introduction of reporter tags at the endogenous locus

  • Development of inducible or tissue-specific knockout systems

  • Fine-tuning of expression levels through promoter modifications

Implementation would involve designing guide RNAs targeting ndhG, optimizing delivery methods for chloroplast genome editing, and developing efficient screening protocols for identifying edited plants. This approach would complement traditional methods involving Agrobacterium-mediated transformation and homologous recombination-based gene disruption .

What is the evolutionary significance of ndhG conservation across plant species?

The evolutionary conservation of ndhG across plant species provides insights into photosynthetic adaptation:

Comparative analysis should examine:

  • Sequence conservation of ndhG across plant lineages

  • Correlation between environmental niches and ndh gene conservation

  • Loss of ndh genes in certain plant groups and compensatory mechanisms

  • Co-evolution with other components of photosynthetic machinery

Understanding the evolutionary context helps predict which plant species might be most affected by ndhG manipulation and identifies natural variation that could inform biotechnological applications. This evolutionary perspective is crucial when considering the broader implications of ndhG research in diverse agricultural contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.