Recombinant Nicotiana tabacum Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction

The Photosystem I (PSI) complex, located in the thylakoid membranes of plants, algae, and cyanobacteria, is essential for photosynthesis . Recombinant Nicotiana tabacum Photosystem I assembly protein Ycf4 (ycf4) is a thylakoid protein that is essential for the accumulation of photosystem I (PSI) . Ycf4 is believed to act as a scaffold for PSI assembly .

Functional Role in Photosystem I Assembly

Ycf4 is essential for the stable accumulation of the PSI complex . A study showed that Ycf4-containing complex plays a crucial role in the initial assembly of PSI by mediating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex .

Ycf4-containing complex

Ycf4 exists in a complex, and a study purified a stable Ycf4-containing complex of >1500 kD . This complex includes other proteins such as COP2, PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . Electron microscopy of the purified preparation revealed structures measuring 285 x 185 Å, suggesting large oligomeric states .

Experimental Evidence

A study utilized a tandem affinity purification tagged Ycf4 to purify a stable Ycf4-containing complex . Pulse-chase protein labeling indicated that the PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex .

Genetic Studies

Disruption of ycf4 in C. reinhardtii results in a deficiency in PSI activity and the inability of the mutant cells to grow photoautotrophically . Inactivation of ycf3or ycf4 leads to a deficiency in PSI activity and to the inability of the mutant cells to grow photoautotrophically .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your consideration.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: Tag type is determined during production. Specify your required tag type at the time of order to ensure preferential development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Nicotiana tabacum (Common tobacco)
Target Names
ycf4
Target Protein Sequence
MTWRSEHIWIELITGSRKISNFCWAFILFLGSLGFLLVGTSSYLGRNLISFFPPQQIIFF PQGLVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRF LIKDIQSVRIEVKEGISARRVLYMDIRGQGSIPLTRTDENLTPREIEQKAAELAYFLRVP IEVF
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Gene References Into Functions
  1. Studies have shown that ycf4 knockout mutants can assemble sufficient photosystem I for slow autotrophic growth. PMID: 22517411
Database Links

KEGG: nta:1466297

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Ycf4 in Nicotiana tabacum?

Ycf4 in tobacco functions as an essential assembly factor for photosystem I (PSI). Recent research has demonstrated that Ycf4 is critical for both the assembly of the photosynthetic complex and the regulation of plastid gene expression . The protein forms modules that mediate PSI assembly, specifically facilitating the integration of peripheral PSI subunits and Light-Harvesting Complexes (LHCIs) into the PSI reaction center subcomplex . Comprehensive analysis of Ycf4 knockout mutants has revealed that it plays a fundamental role in maintaining the structural integrity of chloroplasts, including proper development of thylakoid membranes and grana stacking .

Is the Ycf4 gene essential for photosynthesis in tobacco?

This question has been subject to scientific debate, but recent comprehensive studies provide strong evidence that the complete Ycf4 gene is essential for photosynthesis in tobacco. Complete knockout of the Ycf4 gene resulted in plants that were unable to survive photoautotrophically, requiring an external carbon source for growth . These Δycf4 mutants exhibited a distinctive light green to yellow phenotype, which progressed as plants matured. Physiological measurements demonstrated that these plants were photosynthetically incompetent, with dramatically reduced chlorophyll content (decreased by up to 99.98% in non-photosynthetic cells of mature mutants) .

The confusion in earlier literature stemmed from incomplete gene knockouts. Studies reporting non-essential roles for Ycf4 typically deleted only the N-terminal portion (93 of 184 amino acids), while retaining the functionally critical C-terminus .

How does the structure of chloroplasts change in Ycf4 knockout plants?

Transmission electron microscopy (TEM) analysis reveals significant ultrastructural changes in chloroplasts lacking the Ycf4 protein. The key differences include:

ParameterWild-type ChloroplastsΔycf4 Chloroplasts
ShapeOblongRounded/Spherical
SizeLargerSignificantly smaller
Thylakoid arrangementDensely packedLess organized
Grana stackingDiscrete, orderly structureLess discrete, loss of orderly structure
Special featuresNormal structureFormation of vesicular structures

These structural anomalies in Δycf4 chloroplasts resemble those observed in non-green senescing tissues, suggesting a fundamental disruption of thylakoid membrane organization in the absence of Ycf4 .

What explains the discrepancy between studies reporting Ycf4 as essential versus non-essential for photosynthesis?

The primary cause of this discrepancy is the extent of gene deletion in different studies. Research reporting that Ycf4 is non-essential (e.g., Krech et al., 2012) was based on an incomplete knockout where only 93 of 184 amino acids from the N-terminus were removed, leaving the C-terminal portion intact . In contrast, studies demonstrating the essential nature of Ycf4 (including Boudreau et al., 1997, with Chlamydomonas reinhardtii and more recent work with tobacco) involved deletion of the complete open reading frame .

Protein-protein interaction studies provide insight into this discrepancy. In-silico analysis demonstrates that the C-terminus (91 amino acids) of Ycf4 is particularly important for interactions with other chloroplast proteins, including photosystem-I subunits (psaB, psaC, psaH), Light-Harvesting Complex (LHC), and both large (chloroplast-encoded) and small (nuclear-encoded) subunits of RuBisCO . These interactions are stronger with the C-terminal portion than with the N-terminal portion, explaining why plants with only N-terminal deletions could maintain partial function.

What methodology is most effective for generating homoplastic Ycf4 knockout in tobacco?

Based on published research, the following methodological approach is recommended for generating complete homoplastic Ycf4 knockout:

  • Vector construction: Develop a chloroplast transformation vector containing:

    • Left border flanking sequence: PsaI gene along with nucleotides from accD

    • Right border flanking sequence: ycf10 sequence

    • Selection marker: FLARE-S cassette containing aadA (aminoglycoside 3′-adenyltransferase) and gfp (green fluorescent protein)

  • Transformation protocol:

    • Coat the vector on 0.6 μm gold particles

    • Bombard mature dark green leaves (4-6 weeks old) using particle gun

    • Chop bombarded leaves into small sections and culture on RMOP medium with 500 mg/L spectinomycin

  • Selection and verification:

    • Root antibiotic-resistant shoots on MS medium with 30 g/L sucrose

    • Confirm transgene integration using PCR with primers flanking the aadA marker (A19/A20)

    • Assess homoplasmic status using primers flanking psaI and ycf10 genes (S19/S20)

    • Verify complete replacement through Southern blot analysis using genomic DNA digested with BamHI and a biotin-labeled probe

  • Homoplasmy purification:

    • Multiple rounds of selection and screening are required to achieve homoplasmy

    • Chop leaves into small pieces and culture on selective medium

    • Homoplastic Δycf4 plants typically display a distinctive light green to yellow phenotype

How do physiological parameters differ between wild-type and Ycf4 knockout tobacco plants?

Comprehensive physiological assessment reveals significant differences between wild-type and Δycf4 plants:

ParameterWild-typeΔycf4 KnockoutImpact
Total chlorophyll content (topmost young leaves)3.1 mg/g2.6 mg/g16.1% decrease
Total chlorophyll content (mature leaves)NormalDecreased by 99.98%Severe chlorosis
Photosynthetic rate (A)NormalSignificantly reducedPhotosynthetically incompetent
Transpiration rate (E)NormalSignificantly reducedImpaired water relations
Stomatal conductance (gs)NormalSignificantly reducedRestricted gas exchange
Sub-stomatal CO₂ (Ci)NormalAbnormalImpaired carbon assimilation
Growth on MS medium with ≤10 mg/L sucroseNormalUnable to growCarbon starvation
Growth on MS medium with 15-30 mg/L sucroseNormalLimited growthPartial heterotrophy
Photoautotrophic growth in soilNormalUnable to surviveComplete photosynthetic failure

These data clearly demonstrate that complete Ycf4 knockout renders tobacco plants incapable of photoautotrophic growth and severely compromises multiple physiological functions .

How does Ycf4 contribute to the assembly of Photosystem I in coordination with other factors?

Ycf4 functions as part of a modular assembly system for Photosystem I. Research indicates that PSI assembly involves at least two coordinated modules:

  • Module 1: Ycf3-Y3IP1 complex

    • Primarily facilitates the assembly of reaction center subunits

    • Ycf3 is a tetratricopeptide repeat protein that works with its interacting partner Y3IP1

  • Module 2: Oligomeric Ycf4 complex

    • Facilitates the integration of peripheral PSI subunits and LHCIs into the PSI reaction center subcomplex

    • Functions downstream of the Ycf3-Y3IP1 module in the assembly process

This modular assembly system explains why complete PSI assembly requires both factors, with Ycf4 playing a critical role in the later stages of complex formation. The integration of peripheral subunits and light-harvesting complexes is particularly dependent on Ycf4 function .

What specific protein interactions are mediated by the C-terminus of Ycf4?

In-silico protein-protein interaction studies have revealed that the C-terminal region (91 amino acids) of the 184-amino-acid Ycf4 protein is particularly important for functional interactions. Key protein interactions include:

Interaction PartnerRegion of Ycf4Interaction StrengthFunctional Significance
PSI subunit psaBC-terminusStrongCore reaction center assembly
PSI subunit psaCC-terminusStrongIron-sulfur center integration
PSI subunit psaHC-terminusStrongPeripheral subunit assembly
Light-Harvesting Complex (LHC)C-terminusStrongAntenna complex integration
RuBisCO large subunit (rbcL)C-terminusStrongCoordination with carbon fixation
RuBisCO small subunitC-terminusStrongCoordination with carbon fixation

These interaction patterns provide a molecular explanation for why partial knockout of only the N-terminal region allowed residual function, while complete knockout of Ycf4 resulted in total loss of photoautotrophic capacity .

What are the optimal growth conditions for studying Ycf4 knockout tobacco plants?

For successful cultivation and analysis of Δycf4 tobacco mutants, the following conditions are recommended:

  • For initial culture:

    • Medium: RMOP containing MS salts (4.33 g/L), Myoinositol (100 mg/L), BAP (1.0 mg/L), NAA (0.1mg/L)

    • Carbon source: 3% sucrose (30 g/L)

    • Solidification: 0.026% Gelrite

    • Temperature: 25 ± 1°C

    • Light regime: 16 hours light (white light: 100 μmol·m⁻²·s⁻¹), 8 hours dark

  • For maintenance of homoplastic knockout lines:

    • Medium: MS medium with 30 g/L sucrose minimum

    • Selection: Continued spectinomycin (500 mg/L) is advisable to maintain selection pressure

    • Note: Lower sucrose concentrations (≤10 mg/L) will not support growth, while intermediate concentrations (15-30 mg/L) will yield limited growth

  • For phenotypic analysis:

    • Compare plants at equivalent developmental stages rather than chronological age

    • Sample from specific leaf positions (e.g., topmost young leaves vs. mature leaves) for consistent comparisons

    • Maintain wild-type controls under identical conditions

How can researchers effectively analyze changes in chloroplast gene expression in Ycf4 mutants?

Transcriptome analysis of Δycf4 plants revealed specific patterns of altered gene expression. To effectively analyze these changes:

  • Recommended genes for expression analysis:

    • PSI and PSII genes - expression remains largely unchanged in Δycf4 plants

    • Ribosomal genes - expression remains largely unchanged

    • rbcL (RuBisCO large subunit) - shows decreased expression in Δycf4 plants

    • LHC (Light-Harvesting Complex) genes - show decreased expression

    • ATP Synthase genes (particularly atpB and atpL) - show decreased expression

  • Methodological approaches:

    • RNA isolation from both young and mature leaves

    • qRT-PCR for specific gene expression quantification

    • RNA-seq for comprehensive transcriptome analysis

    • Northern blotting to validate key findings

    • Compare results with physiological parameters and protein levels

The differential expression pattern observed (unchanged PSI/PSII/ribosomal genes but decreased rbcL/LHC/ATP Synthase) suggests that Ycf4 has functions beyond just PSI assembly, potentially in coordinating gene expression related to various aspects of photosynthesis .

What challenges might arise when attempting to generate homoplastic Ycf4 knockouts?

Researchers should be aware of several potential challenges:

  • Heteroplasmy persistence:

    • Chloroplast genomes exist in multiple copies, making complete replacement challenging

    • Solution: Multiple rounds of selection on spectinomycin medium are required

    • Verification: Regular PCR and Southern blot analysis to monitor homoplasmy

  • Growth limitations:

    • Complete knockout plants require high sucrose concentrations

    • Plants may appear initially viable but fail to thrive as they mature

    • Solution: Maintain cultures on MS medium with ≥30 g/L sucrose

  • Phenotypic variation:

    • Light green to yellow phenotype may vary in intensity

    • Leaves become progressively paler as plants age

    • Solution: Standardize analysis to specific developmental stages and leaf positions

  • Chloroplast structural analysis challenges:

    • Degrading chloroplasts in knockout plants may be difficult to prepare for TEM

    • Solution: Sample from youngest possible tissues showing the phenotype

    • Use appropriate fixation techniques (e.g., glutaraldehyde followed by osmium tetroxide)

How can researchers reconcile conflicting literature on Ycf4 function?

When faced with contradictory reports on Ycf4 function:

  • Carefully examine knockout strategy:

    • Determine exactly what portion of the gene was deleted (partial vs. complete)

    • The C-terminal region (91 aa) is particularly critical for function

    • Partial knockouts (especially N-terminal only) may retain significant function

  • Consider organism-specific differences:

    • Compare results across species (tobacco vs. Chlamydomonas vs. others)

    • Note that while the core function is conserved, there may be species-specific adaptations

  • Evaluate growth conditions:

    • Heterotrophic vs. photoautotrophic conditions

    • Light intensity and duration

    • Carbon source concentration (crucial for knockout viability)

  • Verify homoplasmy status:

    • Some contradictory results may stem from incomplete homoplasmy

    • Rigorous molecular verification is essential (PCR, Southern blotting)

By systematically addressing these points, researchers can better understand apparently conflicting results in the literature and design experiments that appropriately account for these factors.

What are the promising areas for further research on Ycf4 function?

Several key areas merit further investigation:

  • Structural biology approaches:

    • Determine the high-resolution structure of the full-length Ycf4 protein

    • Map the specific domains responsible for different protein interactions

    • Characterize the oligomeric state of Ycf4 in different functional contexts

  • Temporal dynamics of PSI assembly:

    • Investigate the sequence and timing of Ycf4 interactions during PSI assembly

    • Develop systems for real-time monitoring of assembly intermediates

    • Characterize the handoff between the Ycf3-Y3IP1 module and the Ycf4 module

  • Regulatory roles beyond assembly:

    • Explore how Ycf4 influences gene expression patterns

    • Investigate potential regulatory interactions with nuclear-encoded factors

    • Examine the relationship between Ycf4 and chloroplast translation machinery

  • Evolutionary analysis:

    • Compare Ycf4 function across diverse photosynthetic organisms

    • Identify conserved vs. variable regions and correlate with functional differences

    • Trace the co-evolution of Ycf4 with other photosynthetic components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.